BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0840 (1002 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51711| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0) 84 1e-16 SB_18076| Best HMM Match : GTP_EFTU (HMM E-Value=0.018) 62 9e-10 SB_50386| Best HMM Match : GTP_EFTU (HMM E-Value=1.6e-09) 60 4e-09 SB_8918| Best HMM Match : GTP_EFTU (HMM E-Value=1.09301e-43) 56 6e-08 SB_6016| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_31980| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_54529| Best HMM Match : IncA (HMM E-Value=1.2) 44 3e-04 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 44 3e-04 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 43 3e-04 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 43 3e-04 SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_6223| Best HMM Match : Ras (HMM E-Value=0) 43 3e-04 SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 43 4e-04 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_33514| Best HMM Match : DUF503 (HMM E-Value=1.6) 43 4e-04 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_12405| Best HMM Match : I-set (HMM E-Value=8.8e-21) 42 6e-04 SB_49320| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 42 8e-04 SB_31079| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_1099| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 42 0.001 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 42 0.001 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 42 0.001 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_5984| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 42 0.001 SB_51352| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_29113| Best HMM Match : RVT_1 (HMM E-Value=0.0066) 42 0.001 SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_20313| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_34403| Best HMM Match : IgG_binding_B (HMM E-Value=9.3) 41 0.001 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 41 0.001 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 41 0.001 SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_2327| Best HMM Match : HTH_1 (HMM E-Value=6.1e-11) 41 0.001 SB_37460| Best HMM Match : DUF885 (HMM E-Value=3.2e-06) 41 0.001 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 41 0.002 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 41 0.002 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_13313| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) 41 0.002 SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) 41 0.002 SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) 41 0.002 SB_36830| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_29145| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 41 0.002 SB_4702| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_23190| Best HMM Match : MHC_I_C (HMM E-Value=1.5) 40 0.002 SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) 40 0.002 SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_19440| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) 40 0.002 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_29158| Best HMM Match : CMD (HMM E-Value=7.1e-13) 40 0.002 SB_15539| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_2263| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_1078| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 40 0.003 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_30691| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 40 0.003 SB_22375| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_58985| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 40 0.003 SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_40004| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_39849| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_39508| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 40 0.003 SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_33422| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_28860| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 40 0.003 SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) 40 0.003 SB_16494| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 40 0.003 SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_47968| Best HMM Match : IgG_binding_B (HMM E-Value=5.5) 40 0.004 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 40 0.004 SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 40 0.004 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_28196| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 40 0.004 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) 40 0.004 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_2952| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_2950| Best HMM Match : Phasin (HMM E-Value=4.5) 40 0.004 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 40 0.004 SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_46118| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 40 0.004 SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_32024| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_28480| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_17265| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_17008| Best HMM Match : Galactosyl_T (HMM E-Value=3.6e-30) 40 0.004 SB_16994| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_16846| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) 40 0.004 SB_2348| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_501| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 39 0.006 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 39 0.006 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 39 0.006 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_45891| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 39 0.006 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_41802| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_39942| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_39002| Best HMM Match : Peptidase_M48 (HMM E-Value=0.14) 39 0.006 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 39 0.006 SB_35492| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 39 0.006 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 39 0.006 SB_30812| Best HMM Match : RVT_1 (HMM E-Value=1.2e-40) 39 0.006 SB_29655| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_26469| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_25274| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_25148| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_24974| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 39 0.006 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_21093| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_18654| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 39 0.006 SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) 39 0.006 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 39 0.006 SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_11115| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) 39 0.006 SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) 39 0.006 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 39 0.006 SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 39 0.006 SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_5229| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_4190| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) 39 0.006 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 39 0.006 SB_528| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_59235| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 39 0.006 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 39 0.006 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 39 0.006 SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 39 0.006 SB_47764| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_44512| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_43882| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 39 0.006 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 39 0.006 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 39 0.006 SB_33025| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_29409| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_20651| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) 39 0.006 SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_18693| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_16729| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_16198| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_14581| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_12207| Best HMM Match : Cytochrom_B_N (HMM E-Value=2.3e-07) 39 0.006 SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) 39 0.006 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 39 0.006 SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) 39 0.006 SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_2918| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_969| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_24322| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_5502| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 39 0.007 SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_44073| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_41545| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_30218| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_24684| Best HMM Match : Phage_rep_O (HMM E-Value=2.3) 39 0.007 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 38 0.010 SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) 38 0.010 SB_42593| Best HMM Match : Rho_GDI (HMM E-Value=3.7e-17) 38 0.010 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_29844| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) 38 0.010 SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) 38 0.010 SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 38 0.010 SB_34844| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_29553| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_25820| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) 38 0.010 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 38 0.010 SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_11209| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_9090| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_4674| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_1977| Best HMM Match : Filament_head (HMM E-Value=4.2) 38 0.010 SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) 38 0.013 SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 38 0.013 SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 38 0.013 SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 38 0.013 SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_48895| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) 38 0.013 SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 38 0.013 SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 38 0.013 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 38 0.013 SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) 38 0.013 SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) 38 0.013 SB_24532| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_23196| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) 38 0.013 SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) 38 0.013 SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 38 0.013 SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 38 0.013 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 38 0.013 SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) 38 0.013 SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) 38 0.013 SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) 38 0.013 SB_46862| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_44171| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_43752| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 38 0.013 SB_42847| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_42555| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 38 0.013 SB_40300| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_38658| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 38 0.013 SB_38521| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_38282| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_38080| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_37703| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_37072| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_36604| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_36374| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_35614| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 >SB_51711| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0) Length = 322 Score = 84.2 bits (199), Expect = 1e-16 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +1 Query: 370 GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQ 486 GITIDIALWKFET KYYVT+IDAPGHRDFIKNMITGTSQ Sbjct: 22 GITIDIALWKFETLKYYVTVIDAPGHRDFIKNMITGTSQ 60 Score = 46.8 bits (106), Expect = 3e-05 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = +2 Query: 308 MGKGSFKYAWVLDKLKAERE 367 MGKGSFKYAWVLDKLKAERE Sbjct: 1 MGKGSFKYAWVLDKLKAERE 20 >SB_18076| Best HMM Match : GTP_EFTU (HMM E-Value=0.018) Length = 106 Score = 61.7 bits (143), Expect = 9e-10 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +3 Query: 165 MGKEKTHINIVVIGHVDSGKSTTTGHLIYK 254 M KEK HINIVVIGHVDSGKSTTTGHLIYK Sbjct: 1 MPKEKIHINIVVIGHVDSGKSTTTGHLIYK 30 Score = 35.9 bits (79), Expect = 0.052 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = +2 Query: 257 GGIDKRTIEKFEKEAQEM 310 GGIDKRTIEKFEKE+ E+ Sbjct: 32 GGIDKRTIEKFEKESSEV 49 >SB_50386| Best HMM Match : GTP_EFTU (HMM E-Value=1.6e-09) Length = 123 Score = 59.7 bits (138), Expect = 4e-09 Identities = 23/43 (53%), Positives = 34/43 (79%) Frame = +1 Query: 379 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLI 507 +D+ L +F+T +T++DAPGH+DFI NMITG +QAD A+L+ Sbjct: 1 MDVGLTRFQTKNKVITLMDAPGHKDFIPNMITGAAQADVAILV 43 Score = 46.4 bits (105), Expect = 4e-05 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = +3 Query: 519 TGEFEAGISKNGQTREHALLAFTLGVKQLI 608 TGEFEAG GQTREHA+L +LGV QLI Sbjct: 48 TGEFEAGFESGGQTREHAILVRSLGVTQLI 77 >SB_8918| Best HMM Match : GTP_EFTU (HMM E-Value=1.09301e-43) Length = 547 Score = 55.6 bits (128), Expect = 6e-08 Identities = 31/102 (30%), Positives = 48/102 (47%) Frame = +1 Query: 370 GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIELPVPVNSKLVSLR 549 G T+++ F+T + T++DAPGH+ F+ NMI+G +QAD VL+ + R Sbjct: 207 GNTVEVGRAAFDTDTKHFTLLDAPGHKSFVPNMISGATQADLGVLVISARKGEFETGFER 266 Query: 550 TVKXXXXXXXXXXXXXXXXXXXXNKMDSTEPPYSEPRFEEIK 675 + NKMD ++E R+EEIK Sbjct: 267 GGQTREHAMLAKTAGVKHLVILVNKMDDPTVKWNEERYEEIK 308 Score = 45.6 bits (103), Expect = 6e-05 Identities = 20/33 (60%), Positives = 24/33 (72%) Frame = +3 Query: 510 AAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 608 +A GEFE G + GQTREHA+LA T GVK L+ Sbjct: 254 SARKGEFETGFERGGQTREHAMLAKTAGVKHLV 286 Score = 41.9 bits (94), Expect = 8e-04 Identities = 16/38 (42%), Positives = 28/38 (73%) Frame = +2 Query: 254 SGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 367 +G +DKRT+EK+E+EA+E + ++ +W LD + ER+ Sbjct: 168 TGQVDKRTLEKYEREAKEKNRETWYLSWALDTNQEERD 205 >SB_6016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/46 (45%), Positives = 32/46 (69%) Frame = -1 Query: 141 ILISLFHFTKQYFFDTHHGLQTACNIRDRRGSSRVDLQACKLGTGR 4 ++IS + +++ D ++ L++ + RGSSRVDLQACKLGTGR Sbjct: 57 VIISTYDSAERHVADAYNALRSLGAVEPLRGSSRVDLQACKLGTGR 102 >SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 46.4 bits (105), Expect = 4e-05 Identities = 21/33 (63%), Positives = 25/33 (75%) Frame = -2 Query: 101 LTLTTDYKLRVISEIDGDPLESTCRHASLALAV 3 +T T ++R +DGDPLESTCRHASLALAV Sbjct: 53 ITAVTQRRVRKSVTLDGDPLESTCRHASLALAV 85 >SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 45.6 bits (103), Expect = 6e-05 Identities = 22/40 (55%), Positives = 27/40 (67%) Frame = -2 Query: 122 TSQNNIFLTLTTDYKLRVISEIDGDPLESTCRHASLALAV 3 T+ I +T+T + I+ GDPLESTCRHASLALAV Sbjct: 44 TTTITITITITITTTITTITTTTGDPLESTCRHASLALAV 83 >SB_31980| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 44.4 bits (100), Expect = 1e-04 Identities = 20/24 (83%), Positives = 23/24 (95%) Frame = +1 Query: 4 TASAKLACLQVDSRGSPSISDITR 75 TASAKLACLQVDSRGSPSIS+ ++ Sbjct: 46 TASAKLACLQVDSRGSPSISETSK 69 >SB_54529| Best HMM Match : IncA (HMM E-Value=1.2) Length = 228 Score = 43.6 bits (98), Expect = 3e-04 Identities = 21/32 (65%), Positives = 22/32 (68%) Frame = -2 Query: 98 TLTTDYKLRVISEIDGDPLESTCRHASLALAV 3 T D + EI GDPLESTCRHASLALAV Sbjct: 193 TRIEDTPISSFDEITGDPLESTCRHASLALAV 224 >SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) Length = 207 Score = 43.6 bits (98), Expect = 3e-04 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = -2 Query: 89 TDYKLRVISEIDGDPLESTCRHASLALAV 3 TD + S+ DGDPLESTCRHASLALAV Sbjct: 100 TDVPPQPNSQPDGDPLESTCRHASLALAV 128 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 43.2 bits (97), Expect = 3e-04 Identities = 21/36 (58%), Positives = 27/36 (75%) Frame = -2 Query: 110 NIFLTLTTDYKLRVISEIDGDPLESTCRHASLALAV 3 N +++ T Y +S ++GDPLESTCRHASLALAV Sbjct: 41 NSLISMVTKYVWLSMS-VNGDPLESTCRHASLALAV 75 >SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) Length = 185 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -2 Query: 62 EIDGDPLESTCRHASLALAV 3 E DGDPLESTCRHASLALAV Sbjct: 87 ETDGDPLESTCRHASLALAV 106 >SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 43.2 bits (97), Expect = 3e-04 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = -2 Query: 98 TLTTDYKLRVISEIDGDPLESTCRHASLALAV 3 TL Y I+ DGDPLESTCRHASLALAV Sbjct: 65 TLLQGYPNPRINGEDGDPLESTCRHASLALAV 96 >SB_6223| Best HMM Match : Ras (HMM E-Value=0) Length = 1665 Score = 43.2 bits (97), Expect = 3e-04 Identities = 24/41 (58%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Frame = -1 Query: 123 HFTKQ-YFFDTHHGLQTACNIRDRRGSSRVDLQACKLGTGR 4 HF K YF + L +C RGSSRVDLQACKLGTGR Sbjct: 1621 HFVKATYFLEGDGPLVFSC-YEKLRGSSRVDLQACKLGTGR 1660 >SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = -2 Query: 68 ISEIDGDPLESTCRHASLALAV 3 +S I GDPLESTCRHASLALAV Sbjct: 7 VSSITGDPLESTCRHASLALAV 28 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 42.7 bits (96), Expect = 4e-04 Identities = 19/26 (73%), Positives = 21/26 (80%) Frame = -2 Query: 80 KLRVISEIDGDPLESTCRHASLALAV 3 + R+ E GDPLESTCRHASLALAV Sbjct: 123 RYRICRERQGDPLESTCRHASLALAV 148 >SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 42.7 bits (96), Expect = 4e-04 Identities = 21/32 (65%), Positives = 24/32 (75%) Frame = -2 Query: 98 TLTTDYKLRVISEIDGDPLESTCRHASLALAV 3 T T+ + + E DGDPLESTCRHASLALAV Sbjct: 25 TQETNARHAQMYEKDGDPLESTCRHASLALAV 56 >SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 42.7 bits (96), Expect = 4e-04 Identities = 21/36 (58%), Positives = 25/36 (69%) Frame = -2 Query: 110 NIFLTLTTDYKLRVISEIDGDPLESTCRHASLALAV 3 N+F+ + R S+ GDPLESTCRHASLALAV Sbjct: 11 NVFINQERKLEDRRRSDTVGDPLESTCRHASLALAV 46 >SB_33514| Best HMM Match : DUF503 (HMM E-Value=1.6) Length = 223 Score = 42.7 bits (96), Expect = 4e-04 Identities = 21/33 (63%), Positives = 25/33 (75%) Frame = -2 Query: 101 LTLTTDYKLRVISEIDGDPLESTCRHASLALAV 3 L + Y ++V+S GDPLESTCRHASLALAV Sbjct: 104 LKIRVRYSVKVLSR--GDPLESTCRHASLALAV 134 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 42.3 bits (95), Expect = 6e-04 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -2 Query: 65 SEIDGDPLESTCRHASLALAV 3 S++ GDPLESTCRHASLALAV Sbjct: 2 SKVSGDPLESTCRHASLALAV 22 >SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 42.3 bits (95), Expect = 6e-04 Identities = 21/27 (77%), Positives = 22/27 (81%), Gaps = 2/27 (7%) Frame = +2 Query: 5 RPVPSLHACRSTLEDPR--LSRILHAV 79 RPVPSLHACRSTLEDPR L IL +V Sbjct: 65 RPVPSLHACRSTLEDPREDLEYILESV 91 >SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 42.3 bits (95), Expect = 6e-04 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = -2 Query: 68 ISEIDGDPLESTCRHASLALAV 3 +S DGDPLESTCRHASLALAV Sbjct: 1 MSNDDGDPLESTCRHASLALAV 22 >SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 42.3 bits (95), Expect = 6e-04 Identities = 19/22 (86%), Positives = 21/22 (95%) Frame = +1 Query: 4 TASAKLACLQVDSRGSPSISDI 69 TASAKLACLQVDSRGSP ++DI Sbjct: 46 TASAKLACLQVDSRGSPMMADI 67 >SB_12405| Best HMM Match : I-set (HMM E-Value=8.8e-21) Length = 198 Score = 42.3 bits (95), Expect = 6e-04 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = -1 Query: 69 NIRDRRGSSRVDLQACKLGTGR 4 NI +RGSSRVDLQACKLGTGR Sbjct: 172 NINVQRGSSRVDLQACKLGTGR 193 >SB_49320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 41.9 bits (94), Expect = 8e-04 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -1 Query: 66 IRDRRGSSRVDLQACKLGTGR 4 ++D RGSSRVDLQACKLGTGR Sbjct: 50 LQDYRGSSRVDLQACKLGTGR 70 >SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 41.9 bits (94), Expect = 8e-04 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = -2 Query: 68 ISEIDGDPLESTCRHASLALAV 3 +S + GDPLESTCRHASLALAV Sbjct: 15 VSGVTGDPLESTCRHASLALAV 36 >SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) Length = 546 Score = 41.9 bits (94), Expect = 8e-04 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = -2 Query: 68 ISEIDGDPLESTCRHASLALAV 3 + + DGDPLESTCRHASLALAV Sbjct: 247 VEKQDGDPLESTCRHASLALAV 268 >SB_31079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 41.9 bits (94), Expect = 8e-04 Identities = 18/20 (90%), Positives = 20/20 (100%) Frame = -2 Query: 62 EIDGDPLESTCRHASLALAV 3 +I+GDPLESTCRHASLALAV Sbjct: 2 DINGDPLESTCRHASLALAV 21 >SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 41.9 bits (94), Expect = 8e-04 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -2 Query: 65 SEIDGDPLESTCRHASLALAV 3 S+ +GDPLESTCRHASLALAV Sbjct: 2 SKFEGDPLESTCRHASLALAV 22 >SB_1099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 41.9 bits (94), Expect = 8e-04 Identities = 22/26 (84%), Positives = 22/26 (84%), Gaps = 2/26 (7%) Frame = +1 Query: 4 TASAKLACLQVDSRGSPS--ISDITR 75 TASAKLACLQVDSRGSP ISDI R Sbjct: 46 TASAKLACLQVDSRGSPGTVISDINR 71 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 41.5 bits (93), Expect = 0.001 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -2 Query: 56 DGDPLESTCRHASLALAV 3 DGDPLESTCRHASLALAV Sbjct: 22 DGDPLESTCRHASLALAV 39 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 41.5 bits (93), Expect = 0.001 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -2 Query: 56 DGDPLESTCRHASLALAV 3 DGDPLESTCRHASLALAV Sbjct: 6 DGDPLESTCRHASLALAV 23 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 41.5 bits (93), Expect = 0.001 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -2 Query: 56 DGDPLESTCRHASLALAV 3 DGDPLESTCRHASLALAV Sbjct: 45 DGDPLESTCRHASLALAV 62 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 41.5 bits (93), Expect = 0.001 Identities = 22/41 (53%), Positives = 24/41 (58%) Frame = -2 Query: 125 FTSQNNIFLTLTTDYKLRVISEIDGDPLESTCRHASLALAV 3 FT L D L + + GDPLESTCRHASLALAV Sbjct: 21 FTCLTTGRLQFRIDQCLHQVCALFGDPLESTCRHASLALAV 61 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 41.5 bits (93), Expect = 0.001 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -2 Query: 62 EIDGDPLESTCRHASLALAV 3 E +GDPLESTCRHASLALAV Sbjct: 635 ECEGDPLESTCRHASLALAV 654 >SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) Length = 154 Score = 41.5 bits (93), Expect = 0.001 Identities = 19/33 (57%), Positives = 26/33 (78%) Frame = -2 Query: 101 LTLTTDYKLRVISEIDGDPLESTCRHASLALAV 3 L + + ++R + + +GDPLESTCRHASLALAV Sbjct: 44 LVVVANIQMRAL-KTEGDPLESTCRHASLALAV 75 >SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 41.5 bits (93), Expect = 0.001 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -2 Query: 56 DGDPLESTCRHASLALAV 3 DGDPLESTCRHASLALAV Sbjct: 5 DGDPLESTCRHASLALAV 22 >SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 41.5 bits (93), Expect = 0.001 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 60 DRRGSSRVDLQACKLGTGR 4 D RGSSRVDLQACKLGTGR Sbjct: 9 DNRGSSRVDLQACKLGTGR 27 >SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 41.5 bits (93), Expect = 0.001 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = -2 Query: 74 RVISEIDGDPLESTCRHASLALAV 3 +V+ + GDPLESTCRHASLALAV Sbjct: 22 KVVKLLAGDPLESTCRHASLALAV 45 >SB_5984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 41.5 bits (93), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +2 Query: 5 RPVPSLHACRSTLEDPR 55 RPVPSLHACRSTLEDPR Sbjct: 46 RPVPSLHACRSTLEDPR 62 >SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) Length = 338 Score = 41.5 bits (93), Expect = 0.001 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = +1 Query: 4 TASAKLACLQVDSRGSPSISDIT 72 TASAKLACLQVDSRGSP + IT Sbjct: 68 TASAKLACLQVDSRGSPEVEFIT 90 >SB_51352| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 41.5 bits (93), Expect = 0.001 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -2 Query: 56 DGDPLESTCRHASLALAV 3 DGDPLESTCRHASLALAV Sbjct: 48 DGDPLESTCRHASLALAV 65 >SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 41.5 bits (93), Expect = 0.001 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -2 Query: 56 DGDPLESTCRHASLALAV 3 DGDPLESTCRHASLALAV Sbjct: 20 DGDPLESTCRHASLALAV 37 >SB_29113| Best HMM Match : RVT_1 (HMM E-Value=0.0066) Length = 444 Score = 41.5 bits (93), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +2 Query: 5 RPVPSLHACRSTLEDPR 55 RPVPSLHACRSTLEDPR Sbjct: 227 RPVPSLHACRSTLEDPR 243 >SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 41.5 bits (93), Expect = 0.001 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -2 Query: 65 SEIDGDPLESTCRHASLALAV 3 S I GDPLESTCRHASLALAV Sbjct: 67 SAIHGDPLESTCRHASLALAV 87 >SB_20313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 41.5 bits (93), Expect = 0.001 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = +2 Query: 5 RPVPSLHACRSTLEDPRLSRIL 70 RPVPSLHACRSTLEDP L ++ Sbjct: 46 RPVPSLHACRSTLEDPPLETLI 67 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -2 Query: 62 EIDGDPLESTCRHASLALAV 3 ++ GDPLESTCRHASLALAV Sbjct: 14 QVSGDPLESTCRHASLALAV 33 >SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -2 Query: 62 EIDGDPLESTCRHASLALAV 3 ++ GDPLESTCRHASLALAV Sbjct: 14 QVSGDPLESTCRHASLALAV 33 >SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/44 (52%), Positives = 26/44 (59%) Frame = -2 Query: 134 FHFFTSQNNIFLTLTTDYKLRVISEIDGDPLESTCRHASLALAV 3 F SQ + F T L + +GDPLESTCRHASLALAV Sbjct: 6 FSLTLSQLSYFGTFMYRLGLLGLKYDEGDPLESTCRHASLALAV 49 >SB_34403| Best HMM Match : IgG_binding_B (HMM E-Value=9.3) Length = 135 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/33 (66%), Positives = 24/33 (72%), Gaps = 2/33 (6%) Frame = -2 Query: 95 LTTDYKLRVI--SEIDGDPLESTCRHASLALAV 3 + D K R I S + GDPLESTCRHASLALAV Sbjct: 75 IVDDKKQRSIWASWVPGDPLESTCRHASLALAV 107 >SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) Length = 160 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = -2 Query: 74 RVISEIDGDPLESTCRHASLALAV 3 R+ S GDPLESTCRHASLALAV Sbjct: 58 RLYSSPPGDPLESTCRHASLALAV 81 >SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) Length = 137 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = +1 Query: 4 TASAKLACLQVDSRGSPSISDI 69 TASAKLACLQVDSRGSP + DI Sbjct: 68 TASAKLACLQVDSRGSPLLLDI 89 >SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = +1 Query: 4 TASAKLACLQVDSRGSPSISD 66 TASAKLACLQVDSRGSP +S+ Sbjct: 46 TASAKLACLQVDSRGSPEVSN 66 >SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = +1 Query: 4 TASAKLACLQVDSRGSPSISD 66 TASAKLACLQVDSRGSP I D Sbjct: 46 TASAKLACLQVDSRGSPKIID 66 >SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 4 TASAKLACLQVDSRGSPSIS 63 TASAKLACLQVDSRGSP IS Sbjct: 68 TASAKLACLQVDSRGSPGIS 87 >SB_2327| Best HMM Match : HTH_1 (HMM E-Value=6.1e-11) Length = 95 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -1 Query: 84 LQTACNIRDRRGSSRVDLQACKLGTGR 4 L A R RGSSRVDLQACKLGTGR Sbjct: 64 LDVALFERSSRGSSRVDLQACKLGTGR 90 >SB_37460| Best HMM Match : DUF885 (HMM E-Value=3.2e-06) Length = 180 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 57 RRGSSRVDLQACKLGTGR 4 RRGSSRVDLQACKLGTGR Sbjct: 158 RRGSSRVDLQACKLGTGR 175 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/23 (82%), Positives = 21/23 (91%), Gaps = 1/23 (4%) Frame = -2 Query: 68 ISEID-GDPLESTCRHASLALAV 3 +S +D GDPLESTCRHASLALAV Sbjct: 94 VSNLDLGDPLESTCRHASLALAV 116 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/19 (89%), Positives = 19/19 (100%) Frame = -2 Query: 59 IDGDPLESTCRHASLALAV 3 ++GDPLESTCRHASLALAV Sbjct: 6 VNGDPLESTCRHASLALAV 24 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -2 Query: 68 ISEIDGDPLESTCRHASLALAV 3 + E GDPLESTCRHASLALAV Sbjct: 127 VREESGDPLESTCRHASLALAV 148 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = -2 Query: 77 LRVISEIDGDPLESTCRHASLALAV 3 L IS GDPLESTCRHASLALAV Sbjct: 78 LAAISIRGGDPLESTCRHASLALAV 102 >SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/22 (77%), Positives = 20/22 (90%) Frame = -2 Query: 68 ISEIDGDPLESTCRHASLALAV 3 + + +GDPLESTCRHASLALAV Sbjct: 5 VEDKEGDPLESTCRHASLALAV 26 >SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -2 Query: 62 EIDGDPLESTCRHASLALAV 3 ++ GDPLESTCRHASLALAV Sbjct: 17 QLQGDPLESTCRHASLALAV 36 >SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -2 Query: 65 SEIDGDPLESTCRHASLALAV 3 S + GDPLESTCRHASLALAV Sbjct: 31 SGVGGDPLESTCRHASLALAV 51 >SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/34 (55%), Positives = 23/34 (67%) Frame = -2 Query: 104 FLTLTTDYKLRVISEIDGDPLESTCRHASLALAV 3 F+ + V+ + GDPLESTCRHASLALAV Sbjct: 37 FVDWPREVATHVVYQEKGDPLESTCRHASLALAV 70 >SB_13313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/27 (74%), Positives = 22/27 (81%), Gaps = 1/27 (3%) Frame = -1 Query: 81 QTACNIRDRR-GSSRVDLQACKLGTGR 4 +TA N D+ GSSRVDLQACKLGTGR Sbjct: 71 RTASNTADKMWGSSRVDLQACKLGTGR 97 >SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -2 Query: 65 SEIDGDPLESTCRHASLALAV 3 S + GDPLESTCRHASLALAV Sbjct: 19 SSLRGDPLESTCRHASLALAV 39 >SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/24 (83%), Positives = 21/24 (87%) Frame = -2 Query: 74 RVISEIDGDPLESTCRHASLALAV 3 R +S I GDPLESTCRHASLALAV Sbjct: 52 RCVSRI-GDPLESTCRHASLALAV 74 >SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) Length = 162 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -2 Query: 62 EIDGDPLESTCRHASLALAV 3 ++ GDPLESTCRHASLALAV Sbjct: 64 QVPGDPLESTCRHASLALAV 83 >SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) Length = 189 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/26 (73%), Positives = 21/26 (80%) Frame = -2 Query: 80 KLRVISEIDGDPLESTCRHASLALAV 3 K +I+ GDPLESTCRHASLALAV Sbjct: 85 KFGLIATSAGDPLESTCRHASLALAV 110 >SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) Length = 292 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/33 (60%), Positives = 23/33 (69%) Frame = -2 Query: 101 LTLTTDYKLRVISEIDGDPLESTCRHASLALAV 3 +T + RV + GDPLESTCRHASLALAV Sbjct: 23 ITSVISIQARVGTAKGGDPLESTCRHASLALAV 55 >SB_36830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/23 (78%), Positives = 22/23 (95%) Frame = +1 Query: 4 TASAKLACLQVDSRGSPSISDIT 72 TASAKLACLQVDSRGSP+ +++T Sbjct: 46 TASAKLACLQVDSRGSPTENNLT 68 >SB_29145| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1090 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = +1 Query: 4 TASAKLACLQVDSRGSPSISD 66 TASAKLACLQVDSRGSP++ D Sbjct: 491 TASAKLACLQVDSRGSPNLVD 511 >SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) Length = 144 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -2 Query: 62 EIDGDPLESTCRHASLALAV 3 ++ GDPLESTCRHASLALAV Sbjct: 37 DVGGDPLESTCRHASLALAV 56 >SB_4702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +1 Query: 4 TASAKLACLQVDSRGSPSI 60 TASAKLACLQVDSRGSPS+ Sbjct: 46 TASAKLACLQVDSRGSPSV 64 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = -2 Query: 68 ISEIDGDPLESTCRHASLALAV 3 I ++GDPLESTCRHASLALAV Sbjct: 10 IGIMNGDPLESTCRHASLALAV 31 >SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/23 (86%), Positives = 21/23 (91%), Gaps = 1/23 (4%) Frame = -2 Query: 68 ISEID-GDPLESTCRHASLALAV 3 I EI+ GDPLESTCRHASLALAV Sbjct: 20 IEEINAGDPLESTCRHASLALAV 42 >SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -2 Query: 62 EIDGDPLESTCRHASLALAV 3 E+ GDPLESTCRHASLALAV Sbjct: 6 EMFGDPLESTCRHASLALAV 25 >SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +1 Query: 4 TASAKLACLQVDSRGSPSI 60 TASAKLACLQVDSRGSPS+ Sbjct: 46 TASAKLACLQVDSRGSPSL 64 >SB_23190| Best HMM Match : MHC_I_C (HMM E-Value=1.5) Length = 182 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -1 Query: 66 IRDRRGSSRVDLQACKLGTGR 4 + + RGSSRVDLQACKLGTGR Sbjct: 157 VNNSRGSSRVDLQACKLGTGR 177 >SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) Length = 197 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -2 Query: 74 RVISEIDGDPLESTCRHASLALAV 3 R+ +GDPLESTCRHASLALAV Sbjct: 121 RIREAEEGDPLESTCRHASLALAV 144 >SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -2 Query: 62 EIDGDPLESTCRHASLALAV 3 +I GDPLESTCRHASLALAV Sbjct: 3 QIIGDPLESTCRHASLALAV 22 >SB_19440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -1 Query: 66 IRDRRGSSRVDLQACKLGTGR 4 +R RGSSRVDLQACKLGTGR Sbjct: 71 VRVYRGSSRVDLQACKLGTGR 91 >SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -2 Query: 74 RVISEIDGDPLESTCRHASLALAV 3 R+ + GDPLESTCRHASLALAV Sbjct: 13 RIATLAPGDPLESTCRHASLALAV 36 >SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = +1 Query: 4 TASAKLACLQVDSRGSPSISDI 69 TASAKLACLQVDSRGSP +S + Sbjct: 46 TASAKLACLQVDSRGSPIVSGL 67 >SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) Length = 387 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = -2 Query: 83 YKLRVISEIDGDPLESTCRHASLALAV 3 Y R S++ GDPLESTCRHASLALAV Sbjct: 283 YNPRNTSQV-GDPLESTCRHASLALAV 308 >SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +1 Query: 4 TASAKLACLQVDSRGSPSI 60 TASAKLACLQVDSRGSPS+ Sbjct: 68 TASAKLACLQVDSRGSPSL 86 >SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/29 (65%), Positives = 20/29 (68%) Frame = -2 Query: 89 TDYKLRVISEIDGDPLESTCRHASLALAV 3 T Y + GDPLESTCRHASLALAV Sbjct: 13 TRYTYQTTRSTVGDPLESTCRHASLALAV 41 >SB_29158| Best HMM Match : CMD (HMM E-Value=7.1e-13) Length = 146 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -1 Query: 66 IRDRRGSSRVDLQACKLGTGR 4 +RDR GSSRVDLQACKLGTGR Sbjct: 122 VRDR-GSSRVDLQACKLGTGR 141 >SB_15539| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = +1 Query: 4 TASAKLACLQVDSRGSPSISD 66 TASAKLACLQVDSRGSP+I + Sbjct: 46 TASAKLACLQVDSRGSPTIDN 66 >SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -2 Query: 65 SEIDGDPLESTCRHASLALAV 3 S + GDPLESTCRHASLALAV Sbjct: 26 SAVIGDPLESTCRHASLALAV 46 >SB_2263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +1 Query: 4 TASAKLACLQVDSRGSPSI 60 TASAKLACLQVDSRGSPS+ Sbjct: 46 TASAKLACLQVDSRGSPSL 64 >SB_1078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 59 IDGDPLESTCRHASLALAV 3 I GDPLESTCRHASLALAV Sbjct: 65 ITGDPLESTCRHASLALAV 83 >SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -2 Query: 56 DGDPLESTCRHASLALAV 3 +GDPLESTCRHASLALAV Sbjct: 50 EGDPLESTCRHASLALAV 67 >SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 59 IDGDPLESTCRHASLALAV 3 I GDPLESTCRHASLALAV Sbjct: 25 IRGDPLESTCRHASLALAV 43 >SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = +1 Query: 4 TASAKLACLQVDSRGSPSISDITRSL 81 TASAKLACLQVDSRGSPS + SL Sbjct: 68 TASAKLACLQVDSRGSPSCAYYIYSL 93 >SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) Length = 263 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/36 (58%), Positives = 25/36 (69%), Gaps = 3/36 (8%) Frame = -2 Query: 101 LTLTTDYKLRV---ISEIDGDPLESTCRHASLALAV 3 +T+ T KL + + GDPLESTCRHASLALAV Sbjct: 149 ITIATWIKLETMYSLFNLFGDPLESTCRHASLALAV 184 >SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -2 Query: 56 DGDPLESTCRHASLALAV 3 +GDPLESTCRHASLALAV Sbjct: 43 EGDPLESTCRHASLALAV 60 >SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -2 Query: 56 DGDPLESTCRHASLALAV 3 +GDPLESTCRHASLALAV Sbjct: 17 EGDPLESTCRHASLALAV 34 >SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -2 Query: 56 DGDPLESTCRHASLALAV 3 +GDPLESTCRHASLALAV Sbjct: 45 EGDPLESTCRHASLALAV 62 >SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/43 (51%), Positives = 25/43 (58%) Frame = -2 Query: 131 HFFTSQNNIFLTLTTDYKLRVISEIDGDPLESTCRHASLALAV 3 H S I + T+ +S GDPLESTCRHASLALAV Sbjct: 31 HLCPSNCPIQQSYNTNDNTHPLSTDIGDPLESTCRHASLALAV 73 >SB_30691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -1 Query: 66 IRDRRGSSRVDLQACKLGTGR 4 I RGSSRVDLQACKLGTGR Sbjct: 58 ISTERGSSRVDLQACKLGTGR 78 >SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 59 IDGDPLESTCRHASLALAV 3 + GDPLESTCRHASLALAV Sbjct: 57 VGGDPLESTCRHASLALAV 75 >SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) Length = 164 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/21 (80%), Positives = 20/21 (95%) Frame = -2 Query: 65 SEIDGDPLESTCRHASLALAV 3 +++ GDPLESTCRHASLALAV Sbjct: 65 ADLVGDPLESTCRHASLALAV 85 >SB_22375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -2 Query: 56 DGDPLESTCRHASLALAV 3 +GDPLESTCRHASLALAV Sbjct: 13 EGDPLESTCRHASLALAV 30 >SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -2 Query: 56 DGDPLESTCRHASLALAV 3 +GDPLESTCRHASLALAV Sbjct: 54 EGDPLESTCRHASLALAV 71 >SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = -2 Query: 68 ISEIDGDPLESTCRHASLALAV 3 +S + GDPLESTCRHASLALAV Sbjct: 1 LSLLFGDPLESTCRHASLALAV 22 >SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/35 (62%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = -2 Query: 104 FLTLTTDYKLRV-ISEIDGDPLESTCRHASLALAV 3 F T Y+L V + +GDPLESTCRHASLALAV Sbjct: 10 FTTRRILYELGVPLPGDNGDPLESTCRHASLALAV 44 >SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -2 Query: 56 DGDPLESTCRHASLALAV 3 +GDPLESTCRHASLALAV Sbjct: 141 EGDPLESTCRHASLALAV 158 >SB_58985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/42 (52%), Positives = 28/42 (66%) Frame = -2 Query: 128 FFTSQNNIFLTLTTDYKLRVISEIDGDPLESTCRHASLALAV 3 F+ Q+ I+ L + + + I GDPLESTCRHASLALAV Sbjct: 104 FYRIQSKIYPPLPPNIRGKKI----GDPLESTCRHASLALAV 141 >SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 4 TASAKLACLQVDSRGSPSIS 63 TASAKLACLQVDSRGSPS S Sbjct: 68 TASAKLACLQVDSRGSPSHS 87 >SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = +1 Query: 4 TASAKLACLQVDSRGSPSISDITRSL 81 TASAKLACLQVDSRGSP + + R + Sbjct: 46 TASAKLACLQVDSRGSPDRTKLLREI 71 >SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 328 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -2 Query: 56 DGDPLESTCRHASLALAV 3 +GDPLESTCRHASLALAV Sbjct: 232 EGDPLESTCRHASLALAV 249 >SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -2 Query: 56 DGDPLESTCRHASLALAV 3 +GDPLESTCRHASLALAV Sbjct: 33 EGDPLESTCRHASLALAV 50 >SB_40004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = +2 Query: 5 RPVPSLHACRSTLEDPRLSRILH 73 RPVPSLHACRSTLEDP + H Sbjct: 46 RPVPSLHACRSTLEDPPFYVMTH 68 >SB_39849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 5 RPVPSLHACRSTLEDPR 55 RPVPSLHACRSTLEDP+ Sbjct: 46 RPVPSLHACRSTLEDPQ 62 >SB_39508| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 1814 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = +1 Query: 4 TASAKLACLQVDSRGSPSISDITR 75 TASAKLACLQVDSRGSP DI + Sbjct: 738 TASAKLACLQVDSRGSPRNVDICK 761 Score = 33.1 bits (72), Expect = 0.36 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -2 Query: 53 GDPLESTCRHASLALA 6 GDPLESTCRHAS +A Sbjct: 1625 GDPLESTCRHASCVIA 1640 >SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -2 Query: 56 DGDPLESTCRHASLALAV 3 +GDPLESTCRHASLALAV Sbjct: 22 EGDPLESTCRHASLALAV 39 >SB_33422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = +1 Query: 4 TASAKLACLQVDSRGSPSISDI 69 TASAKLACLQVDSRGSP D+ Sbjct: 46 TASAKLACLQVDSRGSPIYDDL 67 >SB_28860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/19 (84%), Positives = 18/19 (94%) Frame = +2 Query: 5 RPVPSLHACRSTLEDPRLS 61 RPVPSLHACRSTLEDP ++ Sbjct: 23 RPVPSLHACRSTLEDPLIN 41 >SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) Length = 140 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = +1 Query: 4 TASAKLACLQVDSRGSPSISDI 69 TASAKLACLQVDSRGSPS + I Sbjct: 68 TASAKLACLQVDSRGSPSKATI 89 >SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -2 Query: 56 DGDPLESTCRHASLALAV 3 +GDPLESTCRHASLALAV Sbjct: 6 EGDPLESTCRHASLALAV 23 >SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) Length = 107 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = +1 Query: 4 TASAKLACLQVDSRGSPSISDIT 72 TASAKLACLQVDSRGSP +T Sbjct: 60 TASAKLACLQVDSRGSPHCGQLT 82 >SB_16494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +1 Query: 4 TASAKLACLQVDSRGSPSI 60 TASAKLACLQVDSRGSP+I Sbjct: 46 TASAKLACLQVDSRGSPAI 64 >SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -2 Query: 65 SEIDGDPLESTCRHASLALAV 3 S+ GDPLESTCRHASLALAV Sbjct: 49 SDDGGDPLESTCRHASLALAV 69 >SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -2 Query: 56 DGDPLESTCRHASLALAV 3 +GDPLESTCRHASLALAV Sbjct: 25 EGDPLESTCRHASLALAV 42 >SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) Length = 118 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +1 Query: 4 TASAKLACLQVDSRGSPSI 60 TASAKLACLQVDSRGSP+I Sbjct: 68 TASAKLACLQVDSRGSPAI 86 >SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = +1 Query: 4 TASAKLACLQVDSRGSPSIS 63 TASAKLACLQVDSRGSP +S Sbjct: 117 TASAKLACLQVDSRGSPLVS 136 >SB_47968| Best HMM Match : IgG_binding_B (HMM E-Value=5.5) Length = 64 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/29 (65%), Positives = 20/29 (68%) Frame = -2 Query: 89 TDYKLRVISEIDGDPLESTCRHASLALAV 3 TD + GDPLESTCRHASLALAV Sbjct: 32 TDPQASTDDTAKGDPLESTCRHASLALAV 60 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -2 Query: 56 DGDPLESTCRHASLALAV 3 +GDPLESTCRHASLALAV Sbjct: 13 NGDPLESTCRHASLALAV 30 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -2 Query: 65 SEIDGDPLESTCRHASLALAV 3 S+ GDPLESTCRHASLALAV Sbjct: 1172 SQGKGDPLESTCRHASLALAV 1192 >SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +1 Query: 4 TASAKLACLQVDSRGSPS 57 TASAKLACLQVDSRGSPS Sbjct: 46 TASAKLACLQVDSRGSPS 63 >SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/36 (55%), Positives = 24/36 (66%), Gaps = 3/36 (8%) Frame = -2 Query: 101 LTLTTDYKLRV---ISEIDGDPLESTCRHASLALAV 3 L L++ Y + + GDPLESTCRHASLALAV Sbjct: 51 LPLSSPYNTTINNTLQHYHGDPLESTCRHASLALAV 86 >SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 59 IDGDPLESTCRHASLALAV 3 + GDPLESTCRHASLALAV Sbjct: 5 VAGDPLESTCRHASLALAV 23 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +1 Query: 4 TASAKLACLQVDSRGSPS 57 TASAKLACLQVDSRGSPS Sbjct: 68 TASAKLACLQVDSRGSPS 85 >SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) Length = 735 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/26 (73%), Positives = 21/26 (80%) Frame = +1 Query: 4 TASAKLACLQVDSRGSPSISDITRSL 81 TASAKLACLQVDSRGSP I ++ L Sbjct: 604 TASAKLACLQVDSRGSPIIGIVSGCL 629 >SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -2 Query: 56 DGDPLESTCRHASLALAV 3 +GDPLESTCRHASLALAV Sbjct: 76 NGDPLESTCRHASLALAV 93 >SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +1 Query: 4 TASAKLACLQVDSRGSPS 57 TASAKLACLQVDSRGSPS Sbjct: 46 TASAKLACLQVDSRGSPS 63 >SB_28196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +2 Query: 5 RPVPSLHACRSTLEDP 52 RPVPSLHACRSTLEDP Sbjct: 46 RPVPSLHACRSTLEDP 61 >SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -2 Query: 62 EIDGDPLESTCRHASLALAV 3 E GDPLESTCRHASLALAV Sbjct: 56 EACGDPLESTCRHASLALAV 75 >SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = +1 Query: 4 TASAKLACLQVDSRGSPSISD 66 TASAKLACLQVDSRGSP S+ Sbjct: 46 TASAKLACLQVDSRGSPFFSE 66 >SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -1 Query: 63 RDRRGSSRVDLQACKLGTGR 4 R RGSSRVDLQACKLGTGR Sbjct: 28 RRYRGSSRVDLQACKLGTGR 47 >SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) Length = 257 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 59 IDGDPLESTCRHASLALAV 3 + GDPLESTCRHASLALAV Sbjct: 160 VAGDPLESTCRHASLALAV 178 >SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -2 Query: 65 SEIDGDPLESTCRHASLALAV 3 S+ GDPLESTCRHASLALAV Sbjct: 2 SKRKGDPLESTCRHASLALAV 22 >SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +1 Query: 4 TASAKLACLQVDSRGSPS 57 TASAKLACLQVDSRGSPS Sbjct: 46 TASAKLACLQVDSRGSPS 63 >SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +1 Query: 4 TASAKLACLQVDSRGSPS 57 TASAKLACLQVDSRGSPS Sbjct: 46 TASAKLACLQVDSRGSPS 63 >SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 59 IDGDPLESTCRHASLALAV 3 + GDPLESTCRHASLALAV Sbjct: 28 LPGDPLESTCRHASLALAV 46 >SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) Length = 143 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = -2 Query: 83 YKLRVISEIDGDPLESTCRHASLALAV 3 YKL + GDPLESTCRHASLALAV Sbjct: 40 YKLSIAD--CGDPLESTCRHASLALAV 64 >SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -2 Query: 68 ISEIDGDPLESTCRHASLALAV 3 I I GDPLESTCRHASLALAV Sbjct: 69 ILAILGDPLESTCRHASLALAV 90 >SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -2 Query: 71 VISEIDGDPLESTCRHASLALAV 3 ++ + GDPLESTCRHASLALAV Sbjct: 38 LVGWVIGDPLESTCRHASLALAV 60 >SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -2 Query: 62 EIDGDPLESTCRHASLALAV 3 + GDPLESTCRHASLALAV Sbjct: 45 DAQGDPLESTCRHASLALAV 64 >SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/20 (85%), Positives = 20/20 (100%) Frame = +1 Query: 4 TASAKLACLQVDSRGSPSIS 63 TASAKLACLQVDSRGSP+++ Sbjct: 101 TASAKLACLQVDSRGSPNLA 120 >SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -2 Query: 65 SEIDGDPLESTCRHASLALAV 3 S GDPLESTCRHASLALAV Sbjct: 37 SSRSGDPLESTCRHASLALAV 57 >SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/28 (71%), Positives = 20/28 (71%) Frame = -2 Query: 86 DYKLRVISEIDGDPLESTCRHASLALAV 3 D K R GDPLESTCRHASLALAV Sbjct: 64 DNKGRRFPNKAGDPLESTCRHASLALAV 91 >SB_2952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +2 Query: 5 RPVPSLHACRSTLEDP 52 RPVPSLHACRSTLEDP Sbjct: 46 RPVPSLHACRSTLEDP 61 >SB_2950| Best HMM Match : Phasin (HMM E-Value=4.5) Length = 234 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -1 Query: 57 RRGSSRVDLQACKLGTGR 4 +RGSSRVDLQACKLGTGR Sbjct: 212 QRGSSRVDLQACKLGTGR 229 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 74 RVISEIDGDPLESTCRHASLALAV 3 R I GDPLESTCRHASLALAV Sbjct: 124 RSIQIRQGDPLESTCRHASLALAV 147 >SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +1 Query: 4 TASAKLACLQVDSRGSPS 57 TASAKLACLQVDSRGSPS Sbjct: 46 TASAKLACLQVDSRGSPS 63 >SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) Length = 172 Score = 39.5 bits (88), Expect = 0.004 Identities = 23/42 (54%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Frame = +1 Query: 4 TASAKLACLQVDSRGSPSISDITRSL*S-VVSVKKILFCEVK 126 TASAKLACLQVDSRGSP + S V++V+ CE K Sbjct: 68 TASAKLACLQVDSRGSPCVRSCPMDKQSTVLAVETREACESK 109 >SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +1 Query: 4 TASAKLACLQVDSRGSPS 57 TASAKLACLQVDSRGSPS Sbjct: 46 TASAKLACLQVDSRGSPS 63 >SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +1 Query: 4 TASAKLACLQVDSRGSPS 57 TASAKLACLQVDSRGSPS Sbjct: 46 TASAKLACLQVDSRGSPS 63 >SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +1 Query: 4 TASAKLACLQVDSRGSPS 57 TASAKLACLQVDSRGSPS Sbjct: 46 TASAKLACLQVDSRGSPS 63 >SB_46118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/19 (89%), Positives = 19/19 (100%) Frame = +1 Query: 4 TASAKLACLQVDSRGSPSI 60 TASAKLACLQVDSRGSP++ Sbjct: 39 TASAKLACLQVDSRGSPAV 57 >SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) Length = 152 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = +1 Query: 4 TASAKLACLQVDSRGSPSISD 66 TASAKLACLQVDSRGSP D Sbjct: 68 TASAKLACLQVDSRGSPRAGD 88 >SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -2 Query: 56 DGDPLESTCRHASLALAV 3 +GDPLESTCRHASLALAV Sbjct: 3 NGDPLESTCRHASLALAV 20 >SB_32024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +1 Query: 4 TASAKLACLQVDSRGSPS 57 TASAKLACLQVDSRGSPS Sbjct: 46 TASAKLACLQVDSRGSPS 63 >SB_28480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +1 Query: 4 TASAKLACLQVDSRGSPS 57 TASAKLACLQVDSRGSPS Sbjct: 46 TASAKLACLQVDSRGSPS 63 >SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -2 Query: 56 DGDPLESTCRHASLALAV 3 +GDPLESTCRHASLALAV Sbjct: 45 NGDPLESTCRHASLALAV 62 >SB_17265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +1 Query: 4 TASAKLACLQVDSRGSPS 57 TASAKLACLQVDSRGSPS Sbjct: 46 TASAKLACLQVDSRGSPS 63 >SB_17008| Best HMM Match : Galactosyl_T (HMM E-Value=3.6e-30) Length = 508 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +2 Query: 5 RPVPSLHACRSTLEDP 52 RPVPSLHACRSTLEDP Sbjct: 418 RPVPSLHACRSTLEDP 433 >SB_16994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +2 Query: 5 RPVPSLHACRSTLEDP 52 RPVPSLHACRSTLEDP Sbjct: 23 RPVPSLHACRSTLEDP 38 >SB_16846| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +1 Query: 4 TASAKLACLQVDSRGSPS 57 TASAKLACLQVDSRGSPS Sbjct: 46 TASAKLACLQVDSRGSPS 63 >SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 59 IDGDPLESTCRHASLALAV 3 I GDPLESTCRHASLALAV Sbjct: 4 IFGDPLESTCRHASLALAV 22 >SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/37 (56%), Positives = 24/37 (64%), Gaps = 2/37 (5%) Frame = -2 Query: 107 IFLTLTTDYK--LRVISEIDGDPLESTCRHASLALAV 3 +FL D + L + GDPLESTCRHASLALAV Sbjct: 28 MFLLFINDMQENLECTLRLFGDPLESTCRHASLALAV 64 >SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) Length = 267 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -2 Query: 56 DGDPLESTCRHASLALAV 3 +GDPLESTCRHASLALAV Sbjct: 26 NGDPLESTCRHASLALAV 43 >SB_2348| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +1 Query: 4 TASAKLACLQVDSRGSPSI 60 TASAKLACLQVDSRGSP I Sbjct: 46 TASAKLACLQVDSRGSPDI 64 >SB_501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +2 Query: 5 RPVPSLHACRSTLEDP 52 RPVPSLHACRSTLEDP Sbjct: 46 RPVPSLHACRSTLEDP 61 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 48 GDPLESTCRHASLALAV 64 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 11 GDPLESTCRHASLALAV 27 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 35 GDPLESTCRHASLALAV 51 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 14 GDPLESTCRHASLALAV 30 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 2 GDPLESTCRHASLALAV 18 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 4 GDPLESTCRHASLALAV 20 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 2 GDPLESTCRHASLALAV 18 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 819 GDPLESTCRHASLALAV 835 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 2 GDPLESTCRHASLALAV 18 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 25 GDPLESTCRHASLALAV 41 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 5 GDPLESTCRHASLALAV 21 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 74 GDPLESTCRHASLALAV 90 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 23 GDPLESTCRHASLALAV 39 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 118 GDPLESTCRHASLALAV 134 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 139 GDPLESTCRHASLALAV 155 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 43 GDPLESTCRHASLALAV 59 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 2 GDPLESTCRHASLALAV 18 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 19 GDPLESTCRHASLALAV 35 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 34 GDPLESTCRHASLALAV 50 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 26 GDPLESTCRHASLALAV 42 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 8 GDPLESTCRHASLALAV 24 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 43 GDPLESTCRHASLALAV 59 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 86 GDPLESTCRHASLALAV 102 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 74 GDPLESTCRHASLALAV 90 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 18 GDPLESTCRHASLALAV 34 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 111 GDPLESTCRHASLALAV 127 >SB_45891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 54 RGSSRVDLQACKLGTGR 4 RGSSRVDLQACKLGTGR Sbjct: 44 RGSSRVDLQACKLGTGR 60 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 63 GDPLESTCRHASLALAV 79 >SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 2 GDPLESTCRHASLALAV 18 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 22 GDPLESTCRHASLALAV 38 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 82 GDPLESTCRHASLALAV 98 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 47 GDPLESTCRHASLALAV 63 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 70 GDPLESTCRHASLALAV 86 >SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) Length = 165 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 70 GDPLESTCRHASLALAV 86 >SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 10 GDPLESTCRHASLALAV 26 >SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 2 GDPLESTCRHASLALAV 18 >SB_41802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 54 RGSSRVDLQACKLGTGR 4 RGSSRVDLQACKLGTGR Sbjct: 52 RGSSRVDLQACKLGTGR 68 >SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 29 GDPLESTCRHASLALAV 45 >SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 62 GDPLESTCRHASLALAV 78 >SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 53 GDPLESTCRHASLALAV 69 >SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1580 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 1049 GDPLESTCRHASLALAV 1065 >SB_39942| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 77 GDPLESTCRHASLALAV 93 >SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 3 GDPLESTCRHASLALAV 19 >SB_39002| Best HMM Match : Peptidase_M48 (HMM E-Value=0.14) Length = 102 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 54 RGSSRVDLQACKLGTGR 4 RGSSRVDLQACKLGTGR Sbjct: 81 RGSSRVDLQACKLGTGR 97 >SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 120 GDPLESTCRHASLALAV 136 >SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = +1 Query: 4 TASAKLACLQVDSRGSPSI 60 TASAKLACLQVDSRGSP + Sbjct: 78 TASAKLACLQVDSRGSPKV 96 >SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 156 GDPLESTCRHASLALAV 172 >SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 45 GDPLESTCRHASLALAV 61 >SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 5 GDPLESTCRHASLALAV 21 >SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) Length = 197 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 102 GDPLESTCRHASLALAV 118 >SB_35492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 54 RGSSRVDLQACKLGTGR 4 RGSSRVDLQACKLGTGR Sbjct: 116 RGSSRVDLQACKLGTGR 132 >SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 25 GDPLESTCRHASLALAV 41 >SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) Length = 242 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 147 GDPLESTCRHASLALAV 163 >SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 8 GDPLESTCRHASLALAV 24 >SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 44 GDPLESTCRHASLALAV 60 >SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 56 GDPLESTCRHASLALAV 72 >SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 3 GDPLESTCRHASLALAV 19 >SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) Length = 249 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 171 GDPLESTCRHASLALAV 187 >SB_30812| Best HMM Match : RVT_1 (HMM E-Value=1.2e-40) Length = 325 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 54 RGSSRVDLQACKLGTGR 4 RGSSRVDLQACKLGTGR Sbjct: 304 RGSSRVDLQACKLGTGR 320 >SB_29655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 54 RGSSRVDLQACKLGTGR 4 RGSSRVDLQACKLGTGR Sbjct: 63 RGSSRVDLQACKLGTGR 79 >SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 47 GDPLESTCRHASLALAV 63 >SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 56 GDPLESTCRHASLALAV 72 >SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 49 GDPLESTCRHASLALAV 65 >SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 3 GDPLESTCRHASLALAV 19 >SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 60 GDPLESTCRHASLALAV 76 >SB_26469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 54 RGSSRVDLQACKLGTGR 4 RGSSRVDLQACKLGTGR Sbjct: 74 RGSSRVDLQACKLGTGR 90 >SB_25274| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 54 RGSSRVDLQACKLGTGR 4 RGSSRVDLQACKLGTGR Sbjct: 111 RGSSRVDLQACKLGTGR 127 >SB_25148| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 54 RGSSRVDLQACKLGTGR 4 RGSSRVDLQACKLGTGR Sbjct: 39 RGSSRVDLQACKLGTGR 55 >SB_24974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 54 RGSSRVDLQACKLGTGR 4 RGSSRVDLQACKLGTGR Sbjct: 21 RGSSRVDLQACKLGTGR 37 >SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 17 GDPLESTCRHASLALAV 33 >SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) Length = 128 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 59 GDPLESTCRHASLALAV 75 >SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 53 GDPLESTCRHASLALAV 3 GDPLESTCRHASLALAV Sbjct: 43 GDPLESTCRHASLALAV 59 >SB_21093| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 48 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 54 RGSSRVDLQACKLGTGR 4 RGSSRVDLQACKLGTGR Sbjct: 27 RGSSRVDLQACKLGTGR 43 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 30,945,186 Number of Sequences: 59808 Number of extensions: 612321 Number of successful extensions: 2213 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2057 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2212 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2991217451 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -