BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0838 (685 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58590| Best HMM Match : Polysacc_deac_1 (HMM E-Value=2.6e-08) 58 7e-09 SB_641| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_47667| Best HMM Match : Ldl_recept_a (HMM E-Value=0) 40 0.002 SB_10498| Best HMM Match : Ldl_recept_a (HMM E-Value=2.7e-07) 40 0.002 SB_4485| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_47409| Best HMM Match : Ldl_recept_a (HMM E-Value=1.2e-17) 38 0.008 SB_56441| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_35576| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_20531| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.017 SB_58974| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.017 SB_50311| Best HMM Match : Ldl_recept_a (HMM E-Value=3.4e-20) 36 0.023 SB_27746| Best HMM Match : MAM (HMM E-Value=1.4013e-45) 36 0.040 SB_48688| Best HMM Match : Ldl_recept_a (HMM E-Value=7.8e-26) 35 0.053 SB_30577| Best HMM Match : Ldl_recept_a (HMM E-Value=2.8e-25) 35 0.053 SB_35846| Best HMM Match : Baculo_p24 (HMM E-Value=1.6) 35 0.071 SB_45709| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.093 SB_51630| Best HMM Match : Fz (HMM E-Value=3.3e-34) 34 0.093 SB_6273| Best HMM Match : MAM (HMM E-Value=0) 34 0.093 SB_47789| Best HMM Match : Ldl_recept_a (HMM E-Value=4.2e-34) 33 0.22 SB_35350| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_4238| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_29580| Best HMM Match : Ldl_recept_a (HMM E-Value=4.2e-38) 33 0.28 SB_13477| Best HMM Match : Ldl_recept_a (HMM E-Value=0) 33 0.28 SB_3253| Best HMM Match : Ldl_recept_a (HMM E-Value=0.00064) 33 0.28 SB_50657| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.38 SB_45605| Best HMM Match : MAM (HMM E-Value=2.1e-16) 32 0.50 SB_18178| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.50 SB_53569| Best HMM Match : EGF_CA (HMM E-Value=0) 31 0.66 SB_18810| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_43823| Best HMM Match : MAM (HMM E-Value=0) 31 0.87 SB_5319| Best HMM Match : Ldl_recept_a (HMM E-Value=7.56701e-44) 31 0.87 SB_43832| Best HMM Match : CBM_14 (HMM E-Value=2.8e-16) 31 1.1 SB_21487| Best HMM Match : MAM (HMM E-Value=0) 31 1.1 SB_19614| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_51898| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_27121| Best HMM Match : CBM_14 (HMM E-Value=5.8e-29) 30 1.5 SB_27119| Best HMM Match : CBM_14 (HMM E-Value=4.1e-15) 30 1.5 SB_26126| Best HMM Match : Ldl_recept_b (HMM E-Value=3e-24) 30 1.5 SB_19979| Best HMM Match : Mo-co_dimer (HMM E-Value=6) 30 1.5 SB_11202| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_13694| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_4762| Best HMM Match : tRNA-synt_1b (HMM E-Value=0.00013) 30 2.0 SB_12083| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_23898| Best HMM Match : Ldl_recept_a (HMM E-Value=1.4013e-45) 29 2.7 SB_2014| Best HMM Match : MAM (HMM E-Value=0) 29 3.5 SB_28040| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_13199| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_43556| Best HMM Match : Ldl_recept_a (HMM E-Value=2.7e-11) 28 6.1 SB_22727| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_17897| Best HMM Match : Ldl_recept_a (HMM E-Value=1.2e-14) 28 6.1 SB_8478| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_5737| Best HMM Match : DED (HMM E-Value=2.9e-18) 28 8.1 SB_326| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 >SB_58590| Best HMM Match : Polysacc_deac_1 (HMM E-Value=2.6e-08) Length = 893 Score = 58.0 bits (134), Expect = 7e-09 Identities = 22/45 (48%), Positives = 32/45 (71%) Frame = +1 Query: 547 APDCDPNQCVLPDCFCSADGTRIPGGIEPNQVPQMVTITFNGAVN 681 A C P+ C LP+CFCS G +PGG+ P ++PQM+ +TF+ A+N Sbjct: 566 AERCHPDVCKLPNCFCS--GALVPGGLNPKEIPQMIMLTFDDAIN 608 >SB_641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 530 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/48 (41%), Positives = 28/48 (58%) Frame = +1 Query: 541 NRAPDCDPNQCVLPDCFCSADGTRIPGGIEPNQVPQMVTITFNGAVNV 684 N A CD +C P+C CS D + PGG+ P PQ++ ITF+ + V Sbjct: 25 NVAEKCDLEKCQPPNCRCS-DDFQPPGGLSPALTPQIIMITFDDDITV 71 >SB_47667| Best HMM Match : Ldl_recept_a (HMM E-Value=0) Length = 3891 Score = 39.5 bits (88), Expect = 0.002 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +2 Query: 419 CPEGKLACGSGDCIEKELFCNGKPDCKDES-MKMLALSNWT 538 C + AC SG C+ K C+G DC D S L ++WT Sbjct: 2168 CASSEFACESGQCVRKSFVCDGDNDCHDGSDESSLVCASWT 2208 Score = 38.7 bits (86), Expect = 0.004 Identities = 26/73 (35%), Positives = 33/73 (45%), Gaps = 1/73 (1%) Frame = +2 Query: 293 CPGGLAFD-IDRQTCDWKTNVKNCDQIEKPRKVLPILKTDEPICPEGKLACGSGDCIEKE 469 CP G+A D +D +TC EK V+P P C GK C +G CI Sbjct: 799 CPYGMALDQLDNKTC------------EKNFTVIPT-----PPCSAGKFTCKNGHCISLR 841 Query: 470 LFCNGKPDCKDES 508 C+G+ DC D S Sbjct: 842 WKCDGENDCVDNS 854 Score = 38.3 bits (85), Expect = 0.006 Identities = 30/117 (25%), Positives = 45/117 (38%) Frame = +2 Query: 158 EPNADQLCDGRPADEYFRLTTEGLPRCRQVRPGLENSVTRLASVRCPGGLAFDIDRQTCD 337 +P Q D R + +G+P C P ++ + SV F D C Sbjct: 2967 KPGTYQCADNRKCISVLEVC-DGIPSC----PAGDDE-SNCGSVNQCAPYHFRCDNFRCV 3020 Query: 338 WKTNVKNCDQIEKPRKVLPILKTDEPICPEGKLACGSGDCIEKELFCNGKPDCKDES 508 +++ V CD I+ R C + C SG CI ++ C+G DC D S Sbjct: 3021 YRSRV--CDGIDDCRDGSDERNCHVTTCTADQFRCPSGRCISRDWLCDGDNDCGDSS 3075 Score = 36.7 bits (81), Expect = 0.017 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +2 Query: 419 CPEGKLACGSGDCIEKELFCNGKPDCKDES 508 CP K C +G CI K C+G+ DC D S Sbjct: 47 CPPTKFLCANGMCIPKSAVCDGENDCGDMS 76 Score = 34.7 bits (76), Expect = 0.071 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +2 Query: 410 EPICPEGKLACGSGDCIEKELFCNGKPDCKDES 508 E CP + C +G C+ + C+G+ DC D S Sbjct: 2245 EVTCPAHEFTCPNGRCVSYDFLCDGEDDCGDFS 2277 Score = 34.7 bits (76), Expect = 0.071 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +2 Query: 419 CPEGKLACGSGDCIEKELFCNGKPDCKDES 508 C + AC +G CI L C+G DC D S Sbjct: 2370 CTGAQFACDNGRCISTRLLCDGDNDCGDNS 2399 Score = 34.3 bits (75), Expect = 0.093 Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +2 Query: 419 CPEGKLACGSGD-CIEKELFCNGKPDCKDES 508 CP G+ C +G CI E C+G+ DC+D S Sbjct: 3086 CPAGQARCATGRRCIPSEWRCDGESDCEDGS 3116 Score = 33.5 bits (73), Expect = 0.16 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 419 CPEGKLACGSGDCIEKELFCNGKPDCKDES 508 CP C SG CI C+G DC D S Sbjct: 2496 CPNHTFKCTSGHCIANSSVCDGDTDCADGS 2525 Score = 33.1 bits (72), Expect = 0.22 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 419 CPEGKLACGSGDCIEKELFCNGKPDCKDES 508 C +G+ +C G CI + C+G DC D S Sbjct: 3207 CADGQFSCDDGLCIARAWKCDGMMDCADAS 3236 Score = 32.3 bits (70), Expect = 0.38 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +2 Query: 416 IC-PEGKLACGSGDCIEKELFCNGKPDCKDES 508 IC P+ + C +G CI K+ C+G DC D S Sbjct: 86 ICDPKLEFQCANGRCINKKWRCDGMKDCADGS 117 Score = 31.1 bits (67), Expect = 0.87 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +2 Query: 419 CPEGKLACGSG-DCIEKELFCNGKPDCKDES 508 C + AC +G CI+++ C+G+ DC D S Sbjct: 1087 CKPFEFACANGRHCIQRKWICDGENDCGDRS 1117 Score = 31.1 bits (67), Expect = 0.87 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +2 Query: 419 CPEGKLACGSGDCIEKELFCNGKPDCKDES 508 C G +C +G CI + C+ + DC D S Sbjct: 2209 CEPGHFSCNNGRCINAKWVCDRENDCGDNS 2238 Score = 31.1 bits (67), Expect = 0.87 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +2 Query: 419 CPEGKLACGSGDCIEKELFCNGKPDCKDES 508 C + C SG+C+ C+G DC D+S Sbjct: 2328 CNVSEFRCTSGECVPASWRCDGDNDCTDKS 2357 Score = 30.3 bits (65), Expect = 1.5 Identities = 13/36 (36%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = +2 Query: 398 LKTDEPICPEGKLACGSGD-CIEKELFCNGKPDCKD 502 L+ C G++ CGS + CI C+G DC D Sbjct: 2280 LRCPPTTCVPGQVKCGSKNLCIPSSWLCDGSDDCGD 2315 Score = 28.3 bits (60), Expect = 6.1 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +2 Query: 419 CPEGKLACGSGDCIEKELFCNGKPDCKDES 508 C C +G C ++ C+G DC D S Sbjct: 910 CSASMFRCANGQCKPRDWVCDGFDDCGDGS 939 Score = 28.3 bits (60), Expect = 6.1 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +2 Query: 419 CPEGKLACGSGDCIEKELFCNGKPDCKDES 508 C + C +G CI +E C+ + DC D S Sbjct: 2457 CDVTQFRCKTGTCITREWRCDHQDDCGDGS 2486 >SB_10498| Best HMM Match : Ldl_recept_a (HMM E-Value=2.7e-07) Length = 106 Score = 39.5 bits (88), Expect = 0.002 Identities = 15/30 (50%), Positives = 17/30 (56%) Frame = +2 Query: 419 CPEGKLACGSGDCIEKELFCNGKPDCKDES 508 CP K C G CI++ CNGK DC D S Sbjct: 4 CPGSKYECRDGTCIDRNEHCNGKIDCPDAS 33 >SB_4485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1769 Score = 38.7 bits (86), Expect = 0.004 Identities = 12/27 (44%), Positives = 21/27 (77%) Frame = +1 Query: 604 GTRIPGGIEPNQVPQMVTITFNGAVNV 684 G +P G++P Q+PQM+ +TF+ A+N+ Sbjct: 1553 GASVPNGLDPKQIPQMIMLTFDDAINM 1579 >SB_47409| Best HMM Match : Ldl_recept_a (HMM E-Value=1.2e-17) Length = 1571 Score = 37.9 bits (84), Expect = 0.008 Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = +2 Query: 413 PICPEGKLACG-SGDCIEKELFCNGKPDCKDES 508 P C G+ CG G+C+ + L CNG+ DC+D S Sbjct: 724 PGCGNGEFYCGVPGECVPQTLRCNGQMDCRDAS 756 Score = 32.3 bits (70), Expect = 0.38 Identities = 15/32 (46%), Positives = 17/32 (53%), Gaps = 5/32 (15%) Frame = +2 Query: 416 ICPEGKLACGSG-----DCIEKELFCNGKPDC 496 +CP G CG+G CI K L CNG DC Sbjct: 1529 LCPSGYFYCGTGPKGEISCITKALRCNGIYDC 1560 >SB_56441| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1717 Score = 37.9 bits (84), Expect = 0.008 Identities = 17/35 (48%), Positives = 21/35 (60%), Gaps = 2/35 (5%) Frame = +2 Query: 404 TDEPICPEG--KLACGSGDCIEKELFCNGKPDCKD 502 +DE C G + C SG+CIE FC+GK DC D Sbjct: 689 SDESGCTCGLHEFQCSSGECIEVATFCDGKKDCGD 723 Score = 28.7 bits (61), Expect = 4.6 Identities = 13/40 (32%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = +2 Query: 392 PILKTDEPICPEGKLACGSGDCIEKELFCNGKPD-CKDES 508 P++ C + C +G+C+ K CNG D C D S Sbjct: 650 PVIAEPGYKCLDHLFTCNNGECVTKTSRCNGMRDSCVDGS 689 >SB_35576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1315 Score = 37.9 bits (84), Expect = 0.008 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = +2 Query: 419 CPEGKLACGSGDCIEKELFCNGKPDCKDES 508 C K AC SG+CI+ C+G DCKD S Sbjct: 1155 CLSSKFACESGECIDVVGLCDGTDDCKDAS 1184 Score = 33.9 bits (74), Expect = 0.12 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +2 Query: 419 CPEGKLACGSGDCIEKELFCNGKPDCKD 502 C + + C SG C++ L C+GK DC+D Sbjct: 1193 CSKDEYQCVSGACVKWPLTCDGKKDCED 1220 Score = 29.9 bits (64), Expect = 2.0 Identities = 25/85 (29%), Positives = 36/85 (42%), Gaps = 2/85 (2%) Frame = +2 Query: 260 ENSVTRLASVRCPGGLAFDIDRQTCDWKTNVKNCDQIEKPRKVLPILKTDEPICPEG--K 433 E V L + G LA IDR +T C+Q LP+ CP+ + Sbjct: 1075 EIKVLVLGESQINGTLAIAIDRIIISTET----CEQ-------LPVHSVPGFRCPDKSTQ 1123 Query: 434 LACGSGDCIEKELFCNGKPDCKDES 508 C +G C+ ++L C+G C D S Sbjct: 1124 FQCVNGQCVSRDLICDGDNACLDFS 1148 >SB_20531| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 796 Score = 36.7 bits (81), Expect = 0.017 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +2 Query: 419 CPEGKLACGSGDCIEKELFCNGKPDCKDES 508 C E + C SGDC+ C+G DC D S Sbjct: 216 CSEEEFPCASGDCVPLTSVCDGSADCSDSS 245 >SB_58974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1831 Score = 36.7 bits (81), Expect = 0.017 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +2 Query: 290 RCPGGLAFDIDRQTCDWKTNVKNCDQ-IEKPRKVLPILKTDEPIC 421 RCP GL + + + CDW V +CD+ P P+ T +P C Sbjct: 1268 RCPAGLKWSVKKTACDWPRYV-DCDRTTSTPPTPTPLTPTTKPAC 1311 Score = 36.3 bits (80), Expect = 0.023 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +2 Query: 290 RCPGGLAFDIDRQTCDWKTNVKNCD-QIEKPRKVLPILKTDEPIC 421 RC GL + I + TCDW NV +CD + P P T +P C Sbjct: 813 RCSPGLKWSITKTTCDWPRNV-DCDRKTPTPPSPTPPTTTPKPAC 856 Score = 32.7 bits (71), Expect = 0.28 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 290 RCPGGLAFDIDRQTCDWKTNVKNCDQ 367 RCP GL + + + TCDW V +CD+ Sbjct: 1023 RCPAGLKWSVKKTTCDWPRYV-DCDR 1047 Score = 31.1 bits (67), Expect = 0.87 Identities = 22/79 (27%), Positives = 35/79 (44%), Gaps = 11/79 (13%) Frame = +2 Query: 290 RCPGGLAFDIDRQTCDWKTNVKNCDQIEKPRKVLPILKTD-----EPICPEGK------L 436 RCP GL + + + CDW V +CD+ P K + + + P+G Sbjct: 1168 RCPAGLKWSVKKTACDWPRYV-DCDRTTSTPPT-PTTKPECDLHCQTLSPDGSCTVAPGY 1225 Query: 437 ACGSGDCIEKELFCNGKPD 493 A +G C++ FC KP+ Sbjct: 1226 AVVNGMCVD-TYFCKEKPN 1243 Score = 30.7 bits (66), Expect = 1.1 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +2 Query: 290 RCPGGLAFDIDRQTCDWKTNVKNCDQ 367 RCP GL + + + CDW V +CD+ Sbjct: 918 RCPAGLKWSVKKTACDWPRYV-DCDR 942 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +2 Query: 293 CPGGLAFDIDRQTCDWKTNVKNCDQIEKPRKVLPIL 400 CP GL ++I++ CD NV NC++ E L IL Sbjct: 1485 CPHGLKWNIEKNACDHPVNV-NCNREEYDVLTLGIL 1519 >SB_50311| Best HMM Match : Ldl_recept_a (HMM E-Value=3.4e-20) Length = 772 Score = 36.3 bits (80), Expect = 0.023 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +2 Query: 419 CPEGKLACGSGDCIEKELFCNGKPDCKDES 508 CP C SG+CI C+GK DC D + Sbjct: 127 CPSNMFLCPSGECIMGTQLCDGKKDCTDNT 156 Score = 34.7 bits (76), Expect = 0.071 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +2 Query: 419 CPEGKLACGSGDCIEKELFCNGKPDCKDES 508 C G+ C +G CI K L+C+G C D S Sbjct: 91 CGSGEFQCDNGKCIRKNLYCDGDFACVDGS 120 >SB_27746| Best HMM Match : MAM (HMM E-Value=1.4013e-45) Length = 622 Score = 35.5 bits (78), Expect = 0.040 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +2 Query: 419 CPEGKLACGSGDCIEKELFCNGKPDCKDES 508 CP C SG+CI CN + DC D + Sbjct: 219 CPSNMFLCPSGECIPTTALCNNENDCSDNA 248 Score = 31.9 bits (69), Expect = 0.50 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +2 Query: 419 CPEGKLACGSGDCIEKELFCNGKPDCKDES 508 C E + C +G C+++ L C+G C D S Sbjct: 183 CLEDEFGCENGQCVKRGLLCDGDKACLDGS 212 >SB_48688| Best HMM Match : Ldl_recept_a (HMM E-Value=7.8e-26) Length = 351 Score = 35.1 bits (77), Expect = 0.053 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +2 Query: 419 CPEGKLACGSGDCIEKELFCNGKPDCKDES 508 C + C G C+ FCNG+ DC D S Sbjct: 74 CRSAEFKCPDGKCVHPSKFCNGESDCTDGS 103 Score = 32.3 bits (70), Expect = 0.38 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +2 Query: 437 ACGSGDCIEKELFCNGKPDCKDES 508 AC G C+ L CNG DC+D S Sbjct: 117 ACADGTCVTWSLTCNGVSDCQDGS 140 >SB_30577| Best HMM Match : Ldl_recept_a (HMM E-Value=2.8e-25) Length = 147 Score = 35.1 bits (77), Expect = 0.053 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +2 Query: 419 CPEGKLACGSGDCIEKELFCNGKPDCKDES 508 C + C G C+ FCNG+ DC D S Sbjct: 74 CRSAEFKCPDGKCVHPSKFCNGESDCTDGS 103 Score = 32.3 bits (70), Expect = 0.38 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +2 Query: 437 ACGSGDCIEKELFCNGKPDCKDES 508 AC G C+ L CNG DC+D S Sbjct: 117 ACADGTCVTWSLTCNGVSDCQDGS 140 >SB_35846| Best HMM Match : Baculo_p24 (HMM E-Value=1.6) Length = 810 Score = 34.7 bits (76), Expect = 0.071 Identities = 25/85 (29%), Positives = 36/85 (42%) Frame = +2 Query: 179 CDGRPADEYFRLTTEGLPRCRQVRPGLENSVTRLASVRCPGGLAFDIDRQTCDWKTNVKN 358 C G+ D T G+P+C + NS T G+ I +T ++KN Sbjct: 49 CSGKTGDS---ATNTGMPKCDEKENQNYNSCT--GDNNRDTGINQSIALRTMTMVNDLKN 103 Query: 359 CDQIEKPRKVLPILKTDEPICPEGK 433 DQ E P + LP+ PI +GK Sbjct: 104 IDQREDPNQELPLGAFKTPIALQGK 128 >SB_45709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1112 Score = 34.3 bits (75), Expect = 0.093 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +2 Query: 419 CPEGKLACGSGDCIEKELFCNGKPDCKDESMKM 517 C + C +G CI+ C+G DC+D S +M Sbjct: 130 CDPSQHTCNNGQCIKASWLCDGASDCQDNSDEM 162 Score = 33.1 bits (72), Expect = 0.22 Identities = 23/78 (29%), Positives = 36/78 (46%), Gaps = 3/78 (3%) Frame = +2 Query: 284 SVRC-PGGLAFDIDRQTCDWKTNVKNCDQIEKPRKVLPILKTDEPI-CPEGKLACGSGD- 454 S RC PG D R C ++ +NC + +P T P+ C + + C G+ Sbjct: 432 SGRCIPGRFRCD-HRSDCLDGSDEQNCQNVTRP--------TPPPVKCRKNERMCADGNG 482 Query: 455 CIEKELFCNGKPDCKDES 508 C+ + C+G+ DC D S Sbjct: 483 CVHRRWICDGERDCLDGS 500 Score = 32.3 bits (70), Expect = 0.38 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +2 Query: 419 CPEGKLACGSGDCIEKELFCNGKPDCKDES 508 CP C + C+ C+G+ DC D S Sbjct: 343 CPPSDFTCANSQCVPNSFRCDGENDCGDRS 372 Score = 31.5 bits (68), Expect = 0.66 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +2 Query: 398 LKTDEPICPEGKLACGSGDCIEKELFCNGKPDCKDES 508 L T + P C +G C+ KE C+G DC D S Sbjct: 294 LSTAKTCNPVTDHTCRNGRCVLKEWLCDGMDDCGDSS 330 >SB_51630| Best HMM Match : Fz (HMM E-Value=3.3e-34) Length = 1120 Score = 34.3 bits (75), Expect = 0.093 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +2 Query: 419 CPEGKLACGSGDCIEKELFCNGKPDCKDES 508 C G+ C S +CI L C+G DC D S Sbjct: 23 CDPGQFECTSSECIPDVLKCDGSEDCADSS 52 >SB_6273| Best HMM Match : MAM (HMM E-Value=0) Length = 4272 Score = 34.3 bits (75), Expect = 0.093 Identities = 15/39 (38%), Positives = 18/39 (46%) Frame = +2 Query: 392 PILKTDEPICPEGKLACGSGDCIEKELFCNGKPDCKDES 508 P T P C G+ C +G CI C+ K DC D S Sbjct: 2541 PPTSTPPPGCNSGEHRCSNGQCINAIQVCDFKKDCSDGS 2579 Score = 33.5 bits (73), Expect = 0.16 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +2 Query: 413 PICPEGKLACGSGDCIEKELFCNGKPDCKD 502 P CP G C G CI + L C+ + DC D Sbjct: 2244 PPCPFGLFRCTDGSCIMQSLRCDYQNDCSD 2273 Score = 32.7 bits (71), Expect = 0.28 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 413 PICPEGKLACGSGDCIEKELFCNGKPDCKDES 508 P+C G+ C G CI+ C+ DC D S Sbjct: 2091 PMCQYGQFRCARGSCIDTGRVCDFTDDCGDNS 2122 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 Query: 428 GKLACGSGDCIEKELFCNGKPDCKDES 508 G + C +G CI+K C+ DC D S Sbjct: 3207 GYVKCTNGGCIQKSKLCDFTDDCGDNS 3233 Score = 28.3 bits (60), Expect = 6.1 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +2 Query: 419 CPEGKLACGSGDCIEKELFCNGKPDCKDES 508 C + C SG CI C+ + DC D S Sbjct: 2783 CSSNQFRCDSGHCISSSSKCDFETDCCDGS 2812 >SB_47789| Best HMM Match : Ldl_recept_a (HMM E-Value=4.2e-34) Length = 262 Score = 33.1 bits (72), Expect = 0.22 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = +2 Query: 401 KTDEPICPEGKLACGSGDCIEKELFCNGKPDCKDES 508 KT C G+ CG+G CI C+ DC D S Sbjct: 182 KTLSGTCAPGQFKCGNGKCIPSSWKCDHDNDCGDNS 217 >SB_35350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 626 Score = 33.1 bits (72), Expect = 0.22 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +2 Query: 419 CPEGKLACGSGDCIEKELFCNGKPDCKDES 508 C + C +G+CI K C+G+ DC ++S Sbjct: 592 CKSSEYQCSTGECIHKSWVCDGEFDCLNKS 621 >SB_4238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1288 Score = 33.1 bits (72), Expect = 0.22 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 419 CPEGKLACGSGDCIEKELFCNGKPDCKD 502 C E ++ CG+G C+ K C+ DC D Sbjct: 667 CSENEITCGNGICVVKRWVCDQDDDCGD 694 Score = 33.1 bits (72), Expect = 0.22 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +2 Query: 419 CPEGKLACGSGDCIEKELFCNGKPDCKDES 508 C + C +G+CI K C+G+ DC ++S Sbjct: 747 CKSSEYQCSTGECIHKSWVCDGEFDCLNKS 776 Score = 31.5 bits (68), Expect = 0.66 Identities = 12/32 (37%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = +2 Query: 416 ICPEGKLACGSG-DCIEKELFCNGKPDCKDES 508 IC +G+ CGS CI + C+G DC + + Sbjct: 788 ICKDGEFQCGSSKQCIPESKVCDGSVDCTNSA 819 >SB_29580| Best HMM Match : Ldl_recept_a (HMM E-Value=4.2e-38) Length = 130 Score = 32.7 bits (71), Expect = 0.28 Identities = 17/63 (26%), Positives = 29/63 (46%), Gaps = 1/63 (1%) Frame = +2 Query: 323 RQTCDWKTNVKNCDQIEKPRKVLPILKTDEPICPEGKLACGSGD-CIEKELFCNGKPDCK 499 + C + KNC + + P P+ +P C + C +G C+++ C+G DC Sbjct: 66 KSDCSGGEDEKNCVKPQTPPPTPPL----KPKCRISQRRCDNGSGCVDRMKICDGMRDCA 121 Query: 500 DES 508 D S Sbjct: 122 DGS 124 Score = 31.1 bits (67), Expect = 0.87 Identities = 12/28 (42%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = +2 Query: 416 ICPEGKLACG-SGDCIEKELFCNGKPDC 496 +C + + CG S CI K C+GK DC Sbjct: 42 VCRDDQFQCGTSRKCIRKSKICDGKSDC 69 Score = 28.7 bits (61), Expect = 4.6 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +2 Query: 419 CPEGKLACGSGDCIEKELFCNGKPDCKDES 508 C + C +G CI + C+ + DC D S Sbjct: 4 CSATEFRCNNGRCITRAFRCDDEDDCLDNS 33 >SB_13477| Best HMM Match : Ldl_recept_a (HMM E-Value=0) Length = 628 Score = 32.7 bits (71), Expect = 0.28 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +2 Query: 419 CPEGKLACGSGDCIEKELFCNGKPDCKDES 508 CP + C +G CI C+G DC D S Sbjct: 10 CPSNRFRCNNGRCIPMSWRCDGDNDCGDMS 39 Score = 31.1 bits (67), Expect = 0.87 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +2 Query: 419 CPEGKLACGSGDCIEKELFCNGKPDCKDES 508 C G+ +C +G CI + C+ DC D S Sbjct: 50 CNSGQFSCSNGRCISRSWVCDRDNDCGDGS 79 Score = 30.7 bits (66), Expect = 1.1 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +2 Query: 419 CPEGKLACGSGDCIEKELFCNGKPDCKDESMKM 517 C + +C +G C+ L C+G DC D S +M Sbjct: 103 CRSWEFSCLNGRCVFYRLVCDGVDDCGDSSDEM 135 Score = 29.1 bits (62), Expect = 3.5 Identities = 13/31 (41%), Positives = 15/31 (48%), Gaps = 3/31 (9%) Frame = +2 Query: 419 CPEGKLAC---GSGDCIEKELFCNGKPDCKD 502 CP + C SG CI CNG+ DC D Sbjct: 192 CPADWVRCFYNSSGLCISTSWLCNGRVDCPD 222 >SB_3253| Best HMM Match : Ldl_recept_a (HMM E-Value=0.00064) Length = 48 Score = 32.7 bits (71), Expect = 0.28 Identities = 15/32 (46%), Positives = 17/32 (53%), Gaps = 5/32 (15%) Frame = +2 Query: 416 ICPEGKLACGSG-----DCIEKELFCNGKPDC 496 +CP G CG+G CI K L CNG DC Sbjct: 6 LCPSGYFYCGTGPKGEISCINKALRCNGIYDC 37 >SB_50657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 442 Score = 32.3 bits (70), Expect = 0.38 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +2 Query: 419 CPEGKLACGSGDCIEKELFCNGKPDCKDES 508 C G C +G CI L C+ DC DES Sbjct: 5 CKAGDFRCANGRCISGALVCDLDDDCGDES 34 >SB_45605| Best HMM Match : MAM (HMM E-Value=2.1e-16) Length = 187 Score = 31.9 bits (69), Expect = 0.50 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +2 Query: 419 CPEGKLACGSGDCIEKELFCNGKPDCKDES 508 C + C + C++++ CN K DC D S Sbjct: 145 CLASQYVCANSKCVDRDQLCNFKDDCGDNS 174 >SB_18178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 489 Score = 31.9 bits (69), Expect = 0.50 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = +2 Query: 407 DEPICPEGKLACGSGDCIEKELFCNGKPDCKDES 508 D P C SG CI + C+GK DC D S Sbjct: 355 DAPCKISSWFKCRSGVCIPPQWICDGKDDCGDRS 388 >SB_53569| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 921 Score = 31.5 bits (68), Expect = 0.66 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +2 Query: 431 KLACGSGDCIEKELFCNGKPDCKDES 508 +L C +G C +K +C+G+ DC D S Sbjct: 228 QLRCDNGRCEDKRWWCDGQDDCNDGS 253 >SB_18810| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 31.1 bits (67), Expect = 0.87 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 6/41 (14%) Frame = +2 Query: 404 TDEPICPEG-----KLACG-SGDCIEKELFCNGKPDCKDES 508 +DE CP ++ C S C+ + L C+GKPDC D S Sbjct: 36 SDEDDCPNSDCNLEQIYCPVSQKCLNRTLQCDGKPDCSDYS 76 Score = 29.9 bits (64), Expect = 2.0 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = +2 Query: 419 CPEGKLAC-GSGDCIEKELFCNGKPDCKDES 508 C + + C S CI+ C+G PDC D S Sbjct: 6 CNDDQFQCRASKICIKSSFVCDGVPDCNDHS 36 >SB_43823| Best HMM Match : MAM (HMM E-Value=0) Length = 1724 Score = 31.1 bits (67), Expect = 0.87 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 6/41 (14%) Frame = +2 Query: 404 TDEPICPEG-----KLACG-SGDCIEKELFCNGKPDCKDES 508 +DE CP ++ C S C+ + L C+GKPDC D S Sbjct: 1333 SDEDDCPNSDCNLEQIYCPVSQKCLNRTLQCDGKPDCSDYS 1373 Score = 29.9 bits (64), Expect = 2.0 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = +2 Query: 419 CPEGKLAC-GSGDCIEKELFCNGKPDCKDES 508 C + + C S CI+ C+G PDC D S Sbjct: 1303 CNDDQFQCRASKICIKSSFVCDGVPDCNDHS 1333 >SB_5319| Best HMM Match : Ldl_recept_a (HMM E-Value=7.56701e-44) Length = 212 Score = 31.1 bits (67), Expect = 0.87 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +2 Query: 419 CPEGKLACGSG-DCIEKELFCNGKPDCKDES 508 C + AC +G CI+++ C+G+ DC D S Sbjct: 114 CKPFEFACANGRHCIQRKWICDGENDCGDRS 144 >SB_43832| Best HMM Match : CBM_14 (HMM E-Value=2.8e-16) Length = 518 Score = 30.7 bits (66), Expect = 1.1 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 293 CPGGLAFDIDRQTCDWKTNVK 355 CP GL F+ D CDW VK Sbjct: 488 CPPGLIFNTDLMVCDWSHEVK 508 >SB_21487| Best HMM Match : MAM (HMM E-Value=0) Length = 874 Score = 30.7 bits (66), Expect = 1.1 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +2 Query: 419 CPEGKLACGSGDCIEKELFCNGKPDCKDES 508 C C SG+CI +L C+ DC D S Sbjct: 704 CTPESYKCRSGECISLDLLCDFNKDCLDGS 733 >SB_19614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 603 Score = 30.3 bits (65), Expect = 1.5 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = +2 Query: 398 LKTDEPICPEGKLACGSGDCIEKELFCNGKPDCKDES 508 L + E C K C + CI+ CN + DC+D S Sbjct: 385 LVSSEGPCGPKKFTCQNRQCIDDFKQCNNRQDCRDGS 421 >SB_51898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1712 Score = 30.3 bits (65), Expect = 1.5 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +2 Query: 407 DEPICPEGKLACGSGDCIEKELFCNGKPDCKDES 508 D P C E + C +G CI+ + C+ +C D S Sbjct: 1342 DCPPCKENQFRCDNGQCIDGDPRCDKYKNCTDGS 1375 >SB_27121| Best HMM Match : CBM_14 (HMM E-Value=5.8e-29) Length = 339 Score = 30.3 bits (65), Expect = 1.5 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +2 Query: 293 CPGGLAFDIDRQTCDWKTNVKNCD 364 CP GL + + + TCDW V +CD Sbjct: 146 CPSGLKWSVTKTTCDWPRYV-DCD 168 >SB_27119| Best HMM Match : CBM_14 (HMM E-Value=4.1e-15) Length = 220 Score = 30.3 bits (65), Expect = 1.5 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +2 Query: 293 CPGGLAFDIDRQTCDWKTNVKNCD 364 CP GL + + + TCDW V +CD Sbjct: 53 CPSGLKWSVTKTTCDWPRYV-DCD 75 >SB_26126| Best HMM Match : Ldl_recept_b (HMM E-Value=3e-24) Length = 652 Score = 30.3 bits (65), Expect = 1.5 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = +2 Query: 413 PICPEGKLACGS-GDCIEKELFCNGKPDCKD 502 P C G+ C S G CI + C+G DC+D Sbjct: 209 PPCMPGEFKCQSTGRCIPESKVCDGTRDCQD 239 >SB_19979| Best HMM Match : Mo-co_dimer (HMM E-Value=6) Length = 551 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = -3 Query: 179 TTDQRSAHLQLRRHLVASHE-KYCIPANQLITHRDTETRVEPWRSAKTG 36 T+ + HL+ +R L+ + E K + + L+T TE +E WR ++ G Sbjct: 391 TSGRVGQHLKTKRGLITTPELKDLLDSGDLVTATATEKPIEEWRPSELG 439 >SB_11202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1822 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/53 (28%), Positives = 28/53 (52%), Gaps = 2/53 (3%) Frame = -2 Query: 534 QFDSASIFMDSSLQSGLP--LQNNSFSMQSPLPQANLPSGQIGSSVFKIGKTF 382 +FD ++ D + P L +F + SP P+ N+P ++ S+V +I + F Sbjct: 1393 RFDIGCVYRDKRILGAHPKELYECAFDIISPTPEGNVPDAEVISAVAEIIREF 1445 >SB_13694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 767 Score = 29.9 bits (64), Expect = 2.0 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +2 Query: 293 CPGGLAFDIDRQTCDWKTNV 352 CPGGL ++ + CDW NV Sbjct: 107 CPGGLLYNEKTKQCDWPRNV 126 >SB_4762| Best HMM Match : tRNA-synt_1b (HMM E-Value=0.00013) Length = 396 Score = 29.9 bits (64), Expect = 2.0 Identities = 16/41 (39%), Positives = 19/41 (46%) Frame = +2 Query: 137 DDDGAGDEPNADQLCDGRPADEYFRLTTEGLPRCRQVRPGL 259 DD G + D DG D YFRLT + PR +P L Sbjct: 216 DDGGDNGHDDDDDHDDGVMLDPYFRLTRDVAPRIGCPKPSL 256 >SB_12083| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1671 Score = 29.5 bits (63), Expect = 2.7 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +2 Query: 278 LASVRCPGGLAFDIDRQTCDWKTNVKNC 361 +A+ CP GLAF+ CD+ +NV C Sbjct: 342 IANRHCPTGLAFNEAIGMCDYPSNVPGC 369 >SB_23898| Best HMM Match : Ldl_recept_a (HMM E-Value=1.4013e-45) Length = 291 Score = 29.5 bits (63), Expect = 2.7 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +2 Query: 416 ICPEGKLACGSGDCIEKELFCNGKPDCKD 502 +C + K C +G C+ + C+G DC+D Sbjct: 98 VCSQFK--CNNGHCVHRNWKCDGSNDCRD 124 Score = 27.9 bits (59), Expect = 8.1 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +2 Query: 419 CPEGKLACGSGDCIEKELFCNGKPDCKDES 508 C + C +G+CI + C+ DC D S Sbjct: 134 CGSTQFRCRNGNCINRNYVCDKDNDCGDGS 163 >SB_2014| Best HMM Match : MAM (HMM E-Value=0) Length = 2282 Score = 29.1 bits (62), Expect = 3.5 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +2 Query: 419 CPEGKLACGSGDCIEKELFCNGKPDCK 499 C +L C SG C++ C+G DC+ Sbjct: 245 CFTNELTCSSGRCVQSINLCDGVRDCE 271 >SB_28040| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 391 Score = 29.1 bits (62), Expect = 3.5 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 419 CPEGKLACGSGDCIEKELFCNGKPDCKDE 505 C +L C SG C+ C+G DC+ + Sbjct: 267 CFTNELTCSSGRCVPSINLCDGVKDCEQD 295 >SB_13199| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 28.7 bits (61), Expect = 4.6 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +2 Query: 419 CPEGKLACGSGDCIEKELFCNGKPDCKDES 508 CP + C + C+ + C+G DC D S Sbjct: 21 CPRHEFECENKLCVPRTWLCDGDNDCHDGS 50 Score = 28.7 bits (61), Expect = 4.6 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +2 Query: 419 CPEGKLACGSGDCIEKELFCNGKPDCKDES 508 C + CG+ CI + C+G DC D S Sbjct: 65 CGIEEFDCGNSTCIPLTVLCDGLYDCADRS 94 >SB_43556| Best HMM Match : Ldl_recept_a (HMM E-Value=2.7e-11) Length = 65 Score = 28.3 bits (60), Expect = 6.1 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 422 PEGKLACGSGDCIEKELFCNGKPDCKDESMKM 517 P+ C +G CI C+ + DC D S +M Sbjct: 8 PDTSFKCDNGRCISATWVCDTENDCGDNSDEM 39 >SB_22727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 435 Score = 28.3 bits (60), Expect = 6.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 419 CPEGKLACGSGDCIEKELFCNGKPDCK 499 C +L C SG C+ C+G DC+ Sbjct: 311 CFTNELTCSSGRCVPSINLCDGVKDCE 337 >SB_17897| Best HMM Match : Ldl_recept_a (HMM E-Value=1.2e-14) Length = 1217 Score = 28.3 bits (60), Expect = 6.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 419 CPEGKLACGSGDCIEKELFCNGKPDCK 499 C +L C SG C+ C+G DC+ Sbjct: 1140 CFTNELTCSSGRCVPSINLCDGVKDCE 1166 >SB_8478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1033 Score = 28.3 bits (60), Expect = 6.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 419 CPEGKLACGSGDCIEKELFCNGKPDCK 499 C +L C SG C+ C+G DC+ Sbjct: 230 CFTNELTCSSGRCVPSINLCDGVKDCE 256 >SB_5737| Best HMM Match : DED (HMM E-Value=2.9e-18) Length = 1719 Score = 27.9 bits (59), Expect = 8.1 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = +2 Query: 257 LENSVTRLASVRCPGGLAFDIDRQTCDWKTNVK--NCDQIEK 376 L+N + L S R G F+ID + WK + N D++EK Sbjct: 1670 LKNQIAALYSSRQNGTKTFEIDNTSFGWKAIIDQYNRDRVEK 1711 >SB_326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 528 Score = 27.9 bits (59), Expect = 8.1 Identities = 15/54 (27%), Positives = 25/54 (46%) Frame = -1 Query: 514 FHGFIFAVWFTITEQFFFNAISAATSQFTFRTNRFVRFQDW*NFSWLFYLIAIL 353 +HG++ W AA S F+F R F+ W F W+ +++AI+ Sbjct: 164 WHGYVSREWDW--SGILLTGAFAALSIFSFWPIRRRLFEWWLRFHWVLFILAIV 215 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,488,950 Number of Sequences: 59808 Number of extensions: 470224 Number of successful extensions: 1579 Number of sequences better than 10.0: 53 Number of HSP's better than 10.0 without gapping: 1350 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1566 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1769412099 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -