BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0836 (659 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q0GTY5 Cluster: MobD; n=6; Lactococcus lactis|Rep: MobD... 35 2.0 UniRef50_A7TIY9 Cluster: Putative uncharacterized protein; n=1; ... 33 6.1 UniRef50_Q7X3T3 Cluster: Putative immunity protein; n=1; Lactoba... 33 8.0 UniRef50_Q1NR42 Cluster: Sensor protein; n=3; delta proteobacter... 33 8.0 >UniRef50_Q0GTY5 Cluster: MobD; n=6; Lactococcus lactis|Rep: MobD - Lactococcus lactis Length = 505 Score = 34.7 bits (76), Expect = 2.0 Identities = 22/83 (26%), Positives = 41/83 (49%), Gaps = 5/83 (6%) Frame = -2 Query: 376 KKH*HNYFGNIISCTNATLKNGYKIHKKKRITM*KTSXXXXXXXXXXXXXF---KTGNSH 206 K H HN+ +++ TN N ++ +K T+ + S K GNSH Sbjct: 119 KDHLHNHI--VLNATNPLTLNKFQQNKNDLETLKEISDRISKEYGCKIIVRPEQKLGNSH 176 Query: 205 RNWSVFVLSNSFKRE--NKINYI 143 +N+ V++ NS+++E NK+ ++ Sbjct: 177 KNYLVYLAQNSYRKEIKNKLEFL 199 >UniRef50_A7TIY9 Cluster: Putative uncharacterized protein; n=1; Vanderwaltozyma polyspora DSM 70294|Rep: Putative uncharacterized protein - Vanderwaltozyma polyspora DSM 70294 Length = 387 Score = 33.1 bits (72), Expect = 6.1 Identities = 23/58 (39%), Positives = 32/58 (55%) Frame = -3 Query: 624 KVINTKKNGSIFKVVTNNI*N*HNKTDKIIISN*I**LKSFLSIYSIDNGAVLELLII 451 K+ + ++G I V N NKTDK+II N I +KS +SI S DN +L +I Sbjct: 277 KIYCSTRSGLIVSVDLMNKDTIRNKTDKLIIYN-IPDIKSVISIKSGDNNGILYASVI 333 >UniRef50_Q7X3T3 Cluster: Putative immunity protein; n=1; Lactobacillus gasseri|Rep: Putative immunity protein - Lactobacillus gasseri Length = 90 Score = 32.7 bits (71), Expect = 8.0 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +3 Query: 231 NKYKYIYRNVIN-DVFHIVIRFFLCIL*PFFRVAF 332 N KY++ NV + D FH+ ++F+C PF V F Sbjct: 49 NNPKYLFNNVEHHDFFHVFYQYFICSYIPFIDVIF 83 >UniRef50_Q1NR42 Cluster: Sensor protein; n=3; delta proteobacterium MLMS-1|Rep: Sensor protein - delta proteobacterium MLMS-1 Length = 498 Score = 32.7 bits (71), Expect = 8.0 Identities = 13/20 (65%), Positives = 17/20 (85%) Frame = -3 Query: 243 IYIYLFSKLVTLIGTGVSLY 184 +YI LFS +VTL+GTG+ LY Sbjct: 17 LYIVLFSSVVTLLGTGLQLY 36 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 540,904,637 Number of Sequences: 1657284 Number of extensions: 9468687 Number of successful extensions: 20038 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 19371 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20024 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 50000004659 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -