BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0836 (659 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF364550-3|AAK52059.1| 518|Drosophila melanogaster envelope pro... 29 4.2 >AF364550-3|AAK52059.1| 518|Drosophila melanogaster envelope protein protein. Length = 518 Score = 29.5 bits (63), Expect = 4.2 Identities = 22/79 (27%), Positives = 39/79 (49%), Gaps = 1/79 (1%) Frame = -3 Query: 498 SIYSIDNGAVLELLIIIEAKTIRKIN-NMYMV*ILLXXXXXXXNISTIILVISLAAQMLL 322 ++Y +N LE L + AK I K + N Y ++ I T+IL + + Sbjct: 417 TVYINNNVTKLEPLSYLNAKEIIKEHTNTYNTLQIITLTILAIIILTLILYFIYKYKGIP 476 Query: 321 *KMVIKYIKKNELQCEKRH 265 K+++KY K+N Q E+++ Sbjct: 477 KKLIVKYKKENPKQIEQQN 495 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,042,541 Number of Sequences: 53049 Number of extensions: 417331 Number of successful extensions: 654 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 642 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 654 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2827453950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -