BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0834 (683 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29522| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_45853| Best HMM Match : VKG_Carbox (HMM E-Value=8.8e-25) 28 6.1 >SB_29522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 29.1 bits (62), Expect = 3.5 Identities = 13/42 (30%), Positives = 26/42 (61%) Frame = -2 Query: 622 LERCNEPRVDFRKTGDFTVVSNGLAVSRGVHDRIELQGSLNS 497 +ER N+P V+ R + + + L +SR +++ ++GS+NS Sbjct: 30 VERHNKPEVEVRSSKELLLTP--LVISRNEKEKVLIEGSINS 69 >SB_45853| Best HMM Match : VKG_Carbox (HMM E-Value=8.8e-25) Length = 854 Score = 28.3 bits (60), Expect = 6.1 Identities = 13/50 (26%), Positives = 24/50 (48%) Frame = +3 Query: 231 NERILRRWVDKHTELVSWKFITLWENNRVYFKAHNTKYNQYLKMSTSTCN 380 N +R W+ + ++K W+N V K +N+Y++ +TS N Sbjct: 731 NNETIRDWIINPEKNPAYKLKAEWKNMNVAQKFKVWSFNKYMEFATSFWN 780 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,577,160 Number of Sequences: 59808 Number of extensions: 386577 Number of successful extensions: 1263 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1164 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1262 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1769412099 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -