BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0834 (683 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ438610-6|CAD27478.1| 226|Anopheles gambiae hypothetical prote... 25 2.2 U28809-1|AAC47326.1| 140|Anopheles gambiae lysozyme protein. 24 3.9 DQ007317-1|AAY24699.1| 140|Anopheles gambiae lysozyme c-1 protein. 24 3.9 CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein... 23 6.8 AB107248-1|BAE72063.1| 278|Anopheles gambiae Bcl-2 family prote... 23 9.0 >AJ438610-6|CAD27478.1| 226|Anopheles gambiae hypothetical protein protein. Length = 226 Score = 25.0 bits (52), Expect = 2.2 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = +3 Query: 114 IVKKYFPLSFRLIMAGN--YVKLIYRNYNLALKLGSTTNPSNERILRRWVDK 263 IV F LS + G+ YV +Y + LGST N ++ +L+RW K Sbjct: 24 IVTPRFLLSRHKNLEGSAMYVPPLYCDSLSQSFLGSTINGNSSELLKRWRGK 75 >U28809-1|AAC47326.1| 140|Anopheles gambiae lysozyme protein. Length = 140 Score = 24.2 bits (50), Expect = 3.9 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -2 Query: 478 RTSFSYLAGWKNHCS 434 R F+ GWKNHC+ Sbjct: 115 RHGFNAWYGWKNHCN 129 >DQ007317-1|AAY24699.1| 140|Anopheles gambiae lysozyme c-1 protein. Length = 140 Score = 24.2 bits (50), Expect = 3.9 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -2 Query: 478 RTSFSYLAGWKNHCS 434 R F+ GWKNHC+ Sbjct: 115 RHGFNAWYGWKNHCN 129 >CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein protein. Length = 415 Score = 23.4 bits (48), Expect = 6.8 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = +3 Query: 111 DIVKKYFPLSFRLIMAGNYVKLIYRNYNLALKLGSTTNPSNER 239 ++V+ Y P LI GN V + + + L+ GS SNE+ Sbjct: 112 NLVEVYEPPPVVLIDTGNNVVEVNTDDQIVLEDGSVEGESNEQ 154 >AB107248-1|BAE72063.1| 278|Anopheles gambiae Bcl-2 family protein Anob-1 protein. Length = 278 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/36 (30%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +3 Query: 33 VVNNLIIDKRRNTMEYCYKLWVG-NGQDIVKKYFPL 137 ++N I+ + RN+ME+C G G +V++ P+ Sbjct: 85 LLNRKILQRLRNSMEHCMAGSGGLGGGAVVREALPI 120 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 660,966 Number of Sequences: 2352 Number of extensions: 12823 Number of successful extensions: 37 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68995575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -