BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0832 (620 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0861 + 8153108-8153266,8154633-8155136 31 0.74 09_01_0019 + 403078-404211 31 0.97 03_01_0161 + 1307206-1307769,1307979-1308101,1308182-1308286,130... 28 6.9 05_05_0048 + 21884078-21884951,21885586-21885899 27 9.1 03_06_0399 - 33632811-33633107,33633236-33633385,33633705-336340... 27 9.1 03_01_0607 + 4464669-4465367,4466212-4467369,4468005-4469114,446... 27 9.1 >12_01_0861 + 8153108-8153266,8154633-8155136 Length = 220 Score = 31.1 bits (67), Expect = 0.74 Identities = 21/62 (33%), Positives = 28/62 (45%), Gaps = 2/62 (3%) Frame = -2 Query: 517 PITGLVRVPYRYFSSLPPRAGSG*FARLLPSLDVVAVSQAPSPESNP--DSPLPVTTMVV 344 P + L P SS P G RL S +VA+ + P P S+P D P TT+ + Sbjct: 86 PSSQLRAAPRSLLSSPSPHCQEGHDPRLCVSAGLVAIPRCPPPTSSPSLDPPESSTTVAL 145 Query: 343 AE 338 E Sbjct: 146 IE 147 >09_01_0019 + 403078-404211 Length = 377 Score = 30.7 bits (66), Expect = 0.97 Identities = 17/42 (40%), Positives = 21/42 (50%) Frame = +3 Query: 369 GESGFDSGEGA*ETATTSKEGSRRANYPLPARGGSDEK*RYG 494 G S DSG GA ++A K SRR + GSD R+G Sbjct: 321 GASDGDSGSGASDSADDRKRSSRRRRHRKSESSGSDGDERHG 362 >03_01_0161 + 1307206-1307769,1307979-1308101,1308182-1308286, 1308688-1308867,1308988-1309050,1309151-1309345, 1309704-1309805,1309885-1309947,1310045-1310113, 1310215-1310270,1310587-1310755 Length = 562 Score = 27.9 bits (59), Expect = 6.9 Identities = 21/69 (30%), Positives = 30/69 (43%), Gaps = 2/69 (2%) Frame = -2 Query: 478 SSLPPRAGSG*FARLLPSLDVVAVSQAPSPESNPDSPLPVTTMVVAETTIES**GRHLK- 302 SS PP S +RL + S AP P + +P P + V ++ I S G +L Sbjct: 6 SSKPPTPASTPSSRLAAAPSSRVSSAAPHPSPSSSAPTPASRTVYSDRFIPSRAGSNLAL 65 Query: 301 -DASPVLDH 278 D +P H Sbjct: 66 FDLAPSPSH 74 >05_05_0048 + 21884078-21884951,21885586-21885899 Length = 395 Score = 27.5 bits (58), Expect = 9.1 Identities = 19/49 (38%), Positives = 25/49 (51%), Gaps = 3/49 (6%) Frame = +3 Query: 384 DSGEGA*ETATTSKEG---SRRANYPLPARGGSDEK*RYGTLTRPVIGM 521 + G GA + TT EG RRA P P G SD++ RP+IG+ Sbjct: 120 NGGAGASTSQTTGLEGVEVMRRAAAPAPDNGSSDKE----EAARPLIGV 164 >03_06_0399 - 33632811-33633107,33633236-33633385,33633705-33634029, 33635315-33635982,33636967-33637212,33637405-33637545, 33637807-33637856,33637943-33638060,33638304-33638910, 33639339-33639463,33639813-33639869,33639952-33640023, 33640100-33640232,33640305-33640428,33640522-33640576, 33640672-33641322 Length = 1272 Score = 27.5 bits (58), Expect = 9.1 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -2 Query: 430 PSLDVVAVSQAPSPESNPDSPLP 362 P LD ++Q PSP +NP P P Sbjct: 55 PPLDEETLAQFPSPPTNPSPPPP 77 >03_01_0607 + 4464669-4465367,4466212-4467369,4468005-4469114, 4469273-4469314,4469496-4469572,4469671-4469755, 4469818-4469901,4469988-4470089,4470181-4470279, 4470794-4470919 Length = 1193 Score = 27.5 bits (58), Expect = 9.1 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 551 LSSLKYLKCTHSDYGPRKSPVS 486 L+++K L C DYGP P+S Sbjct: 566 LTAIKILSCILEDYGPASVPIS 587 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,051,234 Number of Sequences: 37544 Number of extensions: 377391 Number of successful extensions: 1016 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 988 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1016 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1502076244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -