BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0832 (620 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 23 3.2 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 22 4.2 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 4.2 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 22 5.5 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 22 5.5 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 21 9.7 DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 21 9.7 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 9.7 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 22.6 bits (46), Expect = 3.2 Identities = 15/45 (33%), Positives = 20/45 (44%) Frame = +3 Query: 42 MSQCKPY*GDTANGSIYQFWFLRSYSVTWITVVILELIHAIRTLT 176 M C P DT +Y+F R Y + T VI + + TLT Sbjct: 230 MYACCP--NDTYPMIVYEFSISRHYGILHATYVIPAVTMMLLTLT 272 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 22.2 bits (45), Expect = 4.2 Identities = 10/38 (26%), Positives = 19/38 (50%) Frame = +2 Query: 14 YACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYL 127 Y C + + LRR + ++++VP + +SYL Sbjct: 215 YPCCDEPYPDIFFNITLRRKTLFYTVNLIVPCVSISYL 252 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.2 bits (45), Expect = 4.2 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 420 SKEGSRRANYPLPARGGSDEK*RYG 494 +K S+ AN P PA GG + + G Sbjct: 1014 AKPQSQEANKPKPATGGKGTRPKRG 1038 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.8 bits (44), Expect = 5.5 Identities = 7/38 (18%), Positives = 21/38 (55%) Frame = +2 Query: 14 YACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYL 127 Y C + + ++ +RR + +++++P + +S+L Sbjct: 224 YTCCDEPYLDITFNITMRRKTLFYTVNIIIPCMGISFL 261 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.8 bits (44), Expect = 5.5 Identities = 7/38 (18%), Positives = 21/38 (55%) Frame = +2 Query: 14 YACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYL 127 Y C + + ++ +RR + +++++P + +S+L Sbjct: 224 YTCCDEPYLDITFNITMRRKTLFYTVNIIIPCMGISFL 261 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 21.0 bits (42), Expect = 9.7 Identities = 7/38 (18%), Positives = 21/38 (55%) Frame = +2 Query: 14 YACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYL 127 Y C + + ++ +RR + +++++P + +S+L Sbjct: 220 YTCCDEPYLDITFNITMRRKTLFYTVNLIIPCMGISFL 257 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 21.0 bits (42), Expect = 9.7 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +1 Query: 457 RHGEVVTKNNDT 492 R+ E+V KNNDT Sbjct: 336 RNIEIVAKNNDT 347 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.0 bits (42), Expect = 9.7 Identities = 8/27 (29%), Positives = 14/27 (51%) Frame = -1 Query: 533 LKCTHSDYGPRKSPVSLFFVTTSPCRE 453 L+C S+Y + P + TT+ R+ Sbjct: 769 LQCATSNYSTTRWPATSVITTTTGARQ 795 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,210 Number of Sequences: 438 Number of extensions: 3903 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18460203 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -