BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0831 (449 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY051718-1|AAK93142.1| 522|Drosophila melanogaster LD24919p pro... 28 6.7 AE014297-1537|AAF54828.2| 522|Drosophila melanogaster CG12267-P... 28 6.7 >AY051718-1|AAK93142.1| 522|Drosophila melanogaster LD24919p protein. Length = 522 Score = 27.9 bits (59), Expect = 6.7 Identities = 15/50 (30%), Positives = 28/50 (56%) Frame = -3 Query: 384 QKPYGYVLVVR*P*AHKHGVKKTCFYLHNIKKKNIVILVTYKSFKSTMET 235 Q+ + +V +++ P +G K FYL +K+K+ V ++ S+KS T Sbjct: 379 QEQFIHVKIIKKPGGGSNGPAKA-FYLFQVKEKDTVRMLLDASYKSLYNT 427 >AE014297-1537|AAF54828.2| 522|Drosophila melanogaster CG12267-PA protein. Length = 522 Score = 27.9 bits (59), Expect = 6.7 Identities = 15/50 (30%), Positives = 28/50 (56%) Frame = -3 Query: 384 QKPYGYVLVVR*P*AHKHGVKKTCFYLHNIKKKNIVILVTYKSFKSTMET 235 Q+ + +V +++ P +G K FYL +K+K+ V ++ S+KS T Sbjct: 379 QEQFIHVKIIKKPGGGSNGPAKA-FYLFQVKEKDTVRMLLDASYKSLYNT 427 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,991,777 Number of Sequences: 53049 Number of extensions: 317358 Number of successful extensions: 602 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 584 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 602 length of database: 24,988,368 effective HSP length: 79 effective length of database: 20,797,497 effective search space used: 1455824790 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -