BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0827 (633 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A0YR65 Cluster: Glycerophosphoryl diester phosphodieste... 32 10.0 UniRef50_A2E353 Cluster: Putative uncharacterized protein; n=1; ... 32 10.0 >UniRef50_A0YR65 Cluster: Glycerophosphoryl diester phosphodiesterase; n=1; Lyngbya sp. PCC 8106|Rep: Glycerophosphoryl diester phosphodiesterase - Lyngbya sp. PCC 8106 Length = 1309 Score = 32.3 bits (70), Expect = 10.0 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = -3 Query: 412 KAKEPI-VRSDALEVDYGTLTFTAVFPSISDLQLSNAEVFSYVHEI 278 +AK+P+ VRSDA + DY T V + D + + VHE+ Sbjct: 282 RAKQPLSVRSDAFDGDYEIPTMAEVIELVKDYEAETGKKVGIVHEL 327 >UniRef50_A2E353 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 417 Score = 32.3 bits (70), Expect = 10.0 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = -3 Query: 628 MGSVPDPLPLNYYRVDIPNSNLTVEYHDVKTRGFDTIKIISF 503 +G+ PDP+ L Y ++ SN V Y D KT+ +T+ +F Sbjct: 165 IGNAPDPVTLKYSNIESCESNCGVLYFD-KTQASNTVSFCNF 205 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 510,694,696 Number of Sequences: 1657284 Number of extensions: 8693831 Number of successful extensions: 15868 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15597 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15868 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 46881492319 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -