BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0827 (633 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC26H8.03 |cho2||phosphatidylethanolamine N-methyltransferase ... 27 2.3 SPAC1006.04c |mcp3|mug7|sequence orphan|Schizosaccharomyces pomb... 26 3.9 SPBC3E7.06c |||membrane transporter|Schizosaccharomyces pombe|ch... 25 9.1 SPAC4D7.01c |sec71|sec7a, SPAP8A3.15c|Sec7 domain|Schizosaccharo... 25 9.1 >SPBC26H8.03 |cho2||phosphatidylethanolamine N-methyltransferase Cho2|Schizosaccharomyces pombe|chr 2|||Manual Length = 905 Score = 27.1 bits (57), Expect = 2.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +1 Query: 355 LEFHSQLPMRHFLQLALWLSYC 420 LEF+S L RHF+ L L +C Sbjct: 199 LEFNSWLVFRHFVDLILMCDFC 220 >SPAC1006.04c |mcp3|mug7|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 952 Score = 26.2 bits (55), Expect = 3.9 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = -2 Query: 257 TLLSFSLDSETQSQLGKLLNNIAVSLQEVFEAQGTILMTSY 135 TL FSLD++T SQL + A +L E+ + +L ++ Sbjct: 147 TLYKFSLDNQTFSQLLSRFKSFA-TLTELLQVHNVMLQVNF 186 >SPBC3E7.06c |||membrane transporter|Schizosaccharomyces pombe|chr 2|||Manual Length = 577 Score = 25.0 bits (52), Expect = 9.1 Identities = 6/19 (31%), Positives = 13/19 (68%) Frame = +2 Query: 374 FQCVTSYNWLFGFPIVFEN 430 F V ++ W++G P+ F++ Sbjct: 360 FHSVANFGWIYGMPLFFQS 378 >SPAC4D7.01c |sec71|sec7a, SPAP8A3.15c|Sec7 domain|Schizosaccharomyces pombe|chr 1|||Manual Length = 1811 Score = 25.0 bits (52), Expect = 9.1 Identities = 10/27 (37%), Positives = 20/27 (74%), Gaps = 1/27 (3%) Frame = -3 Query: 343 VFPSISDL-QLSNAEVFSYVHEINPKF 266 V+ +++D+ QL+++ + SYVH NP + Sbjct: 582 VYHTLNDIPQLNSSTIGSYVHSHNPPY 608 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,253,647 Number of Sequences: 5004 Number of extensions: 40956 Number of successful extensions: 82 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 82 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 82 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 281707720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -