BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0827 (633 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_1170 + 24876197-24877070,24877563-24877606,24877805-248779... 27 9.4 06_01_0844 - 6411121-6411129,6411671-6411796,6411980-6412043,641... 27 9.4 >08_02_1170 + 24876197-24877070,24877563-24877606,24877805-24877900, 24877999-24878544 Length = 519 Score = 27.5 bits (58), Expect = 9.4 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +1 Query: 373 LPMRHFLQLALWLSYCI*KLFSANNFKDCTSA 468 LPM L LALWL+ C+ ++ +NN SA Sbjct: 248 LPMAIILFLALWLTLCL--MYCSNNTAKALSA 277 >06_01_0844 - 6411121-6411129,6411671-6411796,6411980-6412043, 6412568-6412695,6412855-6412971,6414936-6415475, 6415554-6417344,6418359-6421407,6421765-6421823, 6422738-6422791 Length = 1978 Score = 27.5 bits (58), Expect = 9.4 Identities = 15/41 (36%), Positives = 25/41 (60%) Frame = -2 Query: 254 LLSFSLDSETQSQLGKLLNNIAVSLQEVFEAQGTILMTSYI 132 L + LD +TQSQ G+LL A++L ++F+ +G T + Sbjct: 1746 LSMYLLDPQTQSQQGRLL--AALALGDLFQNEGLARSTDAV 1784 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,913,549 Number of Sequences: 37544 Number of extensions: 213677 Number of successful extensions: 344 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 341 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 344 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1549385732 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -