BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0822 (547 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q6NKM5 Cluster: LD48059p; n=1; Drosophila melanogaster|... 58 1e-07 UniRef50_UPI0000DA4670 Cluster: PREDICTED: hypothetical protein;... 58 2e-07 UniRef50_A7RNM9 Cluster: Predicted protein; n=4; Eumetazoa|Rep: ... 56 4e-07 UniRef50_Q5C0F6 Cluster: Putative uncharacterized protein; n=1; ... 56 5e-07 UniRef50_UPI0000F2E2E1 Cluster: PREDICTED: similar to SH2-B homo... 55 1e-06 UniRef50_Q59KL1 Cluster: Putative uncharacterized protein; n=1; ... 54 3e-06 UniRef50_A3LSK3 Cluster: Predicted protein; n=7; Fungi/Metazoa g... 50 3e-05 UniRef50_A3LSK4 Cluster: Predicted protein; n=4; Ascomycota|Rep:... 50 4e-05 UniRef50_Q652R5 Cluster: Putative uncharacterized protein P0603C... 42 0.012 UniRef50_UPI0000F2EBE7 Cluster: PREDICTED: similar to COL5A2 pro... 40 0.038 UniRef50_A4M975 Cluster: Putative uncharacterized protein; n=1; ... 39 0.087 UniRef50_A5KL06 Cluster: Putative uncharacterized protein; n=10;... 35 1.4 UniRef50_Q5E0Z7 Cluster: TadG-like protein; n=1; Vibrio fischeri... 33 4.3 UniRef50_A0C4X9 Cluster: Chromosome undetermined scaffold_15, wh... 33 4.3 UniRef50_Q4J6R9 Cluster: Putative uncharacterized protein; n=1; ... 33 4.3 UniRef50_A4ECR2 Cluster: Putative uncharacterized protein; n=1; ... 32 7.5 UniRef50_Q65TR3 Cluster: Putative uncharacterized protein; n=1; ... 32 9.9 UniRef50_Q64MM2 Cluster: Putative uncharacterized protein; n=2; ... 32 9.9 UniRef50_Q0M3P5 Cluster: Aminotransferase class-III:Shikimate/qu... 32 9.9 UniRef50_Q4X1V0 Cluster: Nuclear distribution protein nudE homol... 32 9.9 >UniRef50_Q6NKM5 Cluster: LD48059p; n=1; Drosophila melanogaster|Rep: LD48059p - Drosophila melanogaster (Fruit fly) Length = 46 Score = 58.0 bits (134), Expect = 1e-07 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +3 Query: 156 EHKCWDPKDGELCLVRSKSGETLMEDRSDSDVQ 254 EH C DPKDGEL L+R KSGETLMEDR+ SDVQ Sbjct: 9 EHICCDPKDGELYLIRLKSGETLMEDRNSSDVQ 41 >UniRef50_UPI0000DA4670 Cluster: PREDICTED: hypothetical protein; n=1; Rattus norvegicus|Rep: PREDICTED: hypothetical protein - Rattus norvegicus Length = 440 Score = 57.6 bits (133), Expect = 2e-07 Identities = 31/53 (58%), Positives = 34/53 (64%) Frame = -2 Query: 252 ARQNRYGPPSGFPLTST*PGIVHHLSGPSICAQSAPSFTDWKRDASGVRKSRT 94 ARQ+RYGPP FPL S PGIVHHLSGP+ A+ AP RD VR RT Sbjct: 123 ARQDRYGPPPEFPLASPCPGIVHHLSGPNAYAR-APPPRRGGRDGPVVRPRRT 174 >UniRef50_A7RNM9 Cluster: Predicted protein; n=4; Eumetazoa|Rep: Predicted protein - Nematostella vectensis Length = 53 Score = 56.4 bits (130), Expect = 4e-07 Identities = 26/43 (60%), Positives = 28/43 (65%) Frame = -2 Query: 285 FRPYTQFRRSIARQNRYGPPSGFPLTST*PGIVHHLSGPSICA 157 F P +F ARQNRY PP FPL S GIVHHLSGP+ CA Sbjct: 2 FAPIPKFDDRFARQNRYEPPPEFPLASPYSGIVHHLSGPNRCA 44 >UniRef50_Q5C0F6 Cluster: Putative uncharacterized protein; n=1; Schistosoma japonicum|Rep: Putative uncharacterized protein - Schistosoma japonicum (Blood fluke) Length = 102 Score = 56.0 bits (129), Expect = 5e-07 Identities = 28/49 (57%), Positives = 34/49 (69%) Frame = +1 Query: 106 SHSRGVSFPISE*RRALSTNAGTRKMVNYAWSGRSQGKP*WRTVAILTC 252 +H R VS P + R + S TRKMVNYAW+GRSQ K WR+VA+LTC Sbjct: 27 AHHRPVS-PAAPGRWSTSARVRTRKMVNYAWAGRSQRKLWWRSVAVLTC 74 Score = 54.4 bits (125), Expect = 2e-06 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = +3 Query: 252 QSIVGTGYRGERLIEPSSSWFRPKFPSG 335 +S+V GYRGERLIEPSSSWF PKFPSG Sbjct: 75 KSVVRPGYRGERLIEPSSSWFPPKFPSG 102 >UniRef50_UPI0000F2E2E1 Cluster: PREDICTED: similar to SH2-B homolog,; n=2; Mammalia|Rep: PREDICTED: similar to SH2-B homolog, - Monodelphis domestica Length = 394 Score = 54.8 bits (126), Expect = 1e-06 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = -2 Query: 252 ARQNRYGPPSGFPLTST*PGIVHHLSGPSICAQSAP 145 ARQ+RYGPP FPL S PGIVHHLSGP+ A + P Sbjct: 60 ARQDRYGPPPEFPLASPCPGIVHHLSGPNTHAHAPP 95 >UniRef50_Q59KL1 Cluster: Putative uncharacterized protein; n=1; Candida albicans|Rep: Putative uncharacterized protein - Candida albicans (Yeast) Length = 108 Score = 53.6 bits (123), Expect = 3e-06 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = -1 Query: 253 CTSESLRSSIRVSPDFDLTRHSSPSFGSQHLCS 155 CTSE LR+S RVS F L RHSSPSFGSQ LCS Sbjct: 17 CTSEPLRASTRVSSGFTLFRHSSPSFGSQQLCS 49 Score = 34.3 bits (75), Expect = 1.9 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 300 MVRLVFRPYTQFRRSI 253 MVRLVFRPYTQ RRSI Sbjct: 1 MVRLVFRPYTQIRRSI 16 >UniRef50_A3LSK3 Cluster: Predicted protein; n=7; Fungi/Metazoa group|Rep: Predicted protein - Pichia stipitis (Yeast) Length = 94 Score = 50.4 bits (115), Expect = 3e-05 Identities = 28/51 (54%), Positives = 34/51 (66%) Frame = -1 Query: 544 TFGSSHSASSAYKIGPLGTVIRSPASSFE*AGVLTHLKFENRLRSFRPQCL 392 TFGSS ASSAY+ P + S + G+LT+LKFENRLRSF+PQ L Sbjct: 44 TFGSSRIASSAYQKWPTKSSSFICPRSIKQQGLLTYLKFENRLRSFQPQDL 94 >UniRef50_A3LSK4 Cluster: Predicted protein; n=4; Ascomycota|Rep: Predicted protein - Pichia stipitis (Yeast) Length = 81 Score = 50.0 bits (114), Expect = 4e-05 Identities = 23/40 (57%), Positives = 25/40 (62%) Frame = -2 Query: 285 FRPYTQFRRSIARQNRYGPPSGFPLTST*PGIVHHLSGPS 166 F P +F ARQNRY PP FP S GIVHHLSGP+ Sbjct: 2 FAPIPKFDDRFARQNRYEPPPEFPSASPYSGIVHHLSGPN 41 >UniRef50_Q652R5 Cluster: Putative uncharacterized protein P0603C10.50; n=1; Oryza sativa (japonica cultivar-group)|Rep: Putative uncharacterized protein P0603C10.50 - Oryza sativa subsp. japonica (Rice) Length = 248 Score = 41.5 bits (93), Expect = 0.012 Identities = 18/39 (46%), Positives = 23/39 (58%) Frame = -2 Query: 279 PYTQFRRSIARQNRYGPPSGFPLTST*PGIVHHLSGPSI 163 P + + RQ R+ PP FPLTS I+HHLSGP + Sbjct: 38 PIPKSDKRFVRQYRFEPPLDFPLTSPRSSIIHHLSGPDM 76 Score = 40.7 bits (91), Expect = 0.021 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -1 Query: 337 YPEGNFGRNQLLDGSISLSPL 275 YPEGNFG NQLLDGSI L P+ Sbjct: 19 YPEGNFGGNQLLDGSIGLIPI 39 >UniRef50_UPI0000F2EBE7 Cluster: PREDICTED: similar to COL5A2 protein; n=9; Monodelphis domestica|Rep: PREDICTED: similar to COL5A2 protein - Monodelphis domestica Length = 774 Score = 39.9 bits (89), Expect = 0.038 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -2 Query: 252 ARQNRYGPPSGFPLTST*PGIVH 184 ARQ+RYGPP FPL S PGIVH Sbjct: 24 ARQDRYGPPPEFPLASPCPGIVH 46 >UniRef50_A4M975 Cluster: Putative uncharacterized protein; n=1; Petrotoga mobilis SJ95|Rep: Putative uncharacterized protein - Petrotoga mobilis SJ95 Length = 124 Score = 38.7 bits (86), Expect = 0.087 Identities = 23/63 (36%), Positives = 29/63 (46%), Gaps = 2/63 (3%) Frame = -2 Query: 339 AILRETSDGTSY*MVRLVFRPYTQFRRSIARQNRYGPPSGFPLTST*PGIVHHLSG--PS 166 A+ S TSY VRL F Y R +++GPP GF S+ + H SG P Sbjct: 24 AVPTHVSGRTSYPQVRLAFHSYPHVIRGFFTIHQFGPPLGFTQASSCTWVAHLASGLFPV 83 Query: 165 ICA 157 CA Sbjct: 84 TCA 86 >UniRef50_A5KL06 Cluster: Putative uncharacterized protein; n=10; Bacteria|Rep: Putative uncharacterized protein - Ruminococcus torques ATCC 27756 Length = 245 Score = 34.7 bits (76), Expect = 1.4 Identities = 20/47 (42%), Positives = 24/47 (51%) Frame = -2 Query: 312 TSY*MVRLVFRPYTQFRRSIARQNRYGPPSGFPLTST*PGIVHHLSG 172 TSY VRL F PY ++ +GPP F TST I H +SG Sbjct: 13 TSYLRVRLEFLPYPHLIPTLFNGCGFGPPLPFTATSTWTWIDHPVSG 59 >UniRef50_Q5E0Z7 Cluster: TadG-like protein; n=1; Vibrio fischeri ES114|Rep: TadG-like protein - Vibrio fischeri (strain ATCC 700601 / ES114) Length = 423 Score = 33.1 bits (72), Expect = 4.3 Identities = 23/66 (34%), Positives = 36/66 (54%) Frame = +3 Query: 237 SDSDVQSIVGTGYRGERLIEPSSSWFRPKFPSG*LASI*NFKTVSSGKAND*RHWGRNDL 416 SD+ +Q + G + +P + WFRP P+ +A+I N KT K+ + G +D+ Sbjct: 230 SDTGIQCSLSQGVNSKN--KPGN-WFRPVKPANTVANIWNEKTEDYCKSG--AYAGFHDV 284 Query: 417 NLFSNF 434 NL SNF Sbjct: 285 NLTSNF 290 >UniRef50_A0C4X9 Cluster: Chromosome undetermined scaffold_15, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_15, whole genome shotgun sequence - Paramecium tetraurelia Length = 350 Score = 33.1 bits (72), Expect = 4.3 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 5/46 (10%) Frame = +3 Query: 201 RSKSGETLMEDRSDSDVQSIV-----GTGYRGERLIEPSSSWFRPK 323 + + GE ++E+ SD D+ +V G GYRGE L E + +PK Sbjct: 212 QDEQGEKIIENLSDEDLGKVVRELLRGDGYRGEYLFEDDTKSTKPK 257 >UniRef50_Q4J6R9 Cluster: Putative uncharacterized protein; n=1; Sulfolobus acidocaldarius|Rep: Putative uncharacterized protein - Sulfolobus acidocaldarius Length = 136 Score = 33.1 bits (72), Expect = 4.3 Identities = 22/65 (33%), Positives = 29/65 (44%) Frame = +1 Query: 349 YKILKQSHPVKRMIRGIGAETTSTYSQTLNG*ELRLTRTMKPEI**RCQVGQFCKQNWRC 528 YKI + + IRG G TT+T TLNG E+ K E +G + + Sbjct: 62 YKITENGYVATVQIRGPGVTTTTTTKSTLNGDEVTWEAEYKNEGSMVAMLGNLLDTSVQT 121 Query: 529 GMNQT 543 MNQT Sbjct: 122 MMNQT 126 >UniRef50_A4ECR2 Cluster: Putative uncharacterized protein; n=1; Collinsella aerofaciens ATCC 25986|Rep: Putative uncharacterized protein - Collinsella aerofaciens ATCC 25986 Length = 223 Score = 32.3 bits (70), Expect = 7.5 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = -2 Query: 291 LVFRPYTQFRRSIARQNRYGPPSGFPLTST*PGIVHHLSGP 169 + F PY Q ++ + +GPP G S P I H S P Sbjct: 1 MAFHPYPQVIAAVFNRRAFGPPRGLTPASACPRIAHPASRP 41 >UniRef50_Q65TR3 Cluster: Putative uncharacterized protein; n=1; Mannheimia succiniciproducens MBEL55E|Rep: Putative uncharacterized protein - Mannheimia succiniciproducens (strain MBEL55E) Length = 150 Score = 31.9 bits (69), Expect = 9.9 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = +3 Query: 207 KSGETLMEDRSDSDVQSIVGTGYRGERLIEP 299 KSG+ +DR D Q IV TGY L+EP Sbjct: 47 KSGDGFFQDRLICDNQEIVPTGYLSSTLLEP 77 >UniRef50_Q64MM2 Cluster: Putative uncharacterized protein; n=2; Bacteroides fragilis|Rep: Putative uncharacterized protein - Bacteroides fragilis Length = 550 Score = 31.9 bits (69), Expect = 9.9 Identities = 23/74 (31%), Positives = 33/74 (44%), Gaps = 2/74 (2%) Frame = -1 Query: 307 LLDGSISLSP--LYPVPTIDCTSESLRSSIRVSPDFDLTRHSSPSFGSQHLCSERAFIH* 134 LLD +S+ LYPVP+ C ES VSPD +S FG + + + I Sbjct: 37 LLDEMVSVEEQALYPVPSYTCRQESSYDRASVSPDSAGWFANSDGFGIKRVDTVAGRIEK 96 Query: 133 LETRRLGSAKITNV 92 + +G IT + Sbjct: 97 VMFDEVGPGAITRI 110 >UniRef50_Q0M3P5 Cluster: Aminotransferase class-III:Shikimate/quinate 5-dehydrogenase; n=1; Caulobacter sp. K31|Rep: Aminotransferase class-III:Shikimate/quinate 5-dehydrogenase - Caulobacter sp. K31 Length = 957 Score = 31.9 bits (69), Expect = 9.9 Identities = 20/46 (43%), Positives = 25/46 (54%) Frame = -3 Query: 251 HVRIATVLHQGFP*LRPDQA*FTIFRVPAFVLRARLHSLIGNETPR 114 H IA+ LH G RP A +I R PA +L RL +L+G T R Sbjct: 81 HPEIASALHAGLTAQRPMFAQASI-RAPAALLAERLSALVGRTTGR 125 >UniRef50_Q4X1V0 Cluster: Nuclear distribution protein nudE homolog 1; n=6; Trichocomaceae|Rep: Nuclear distribution protein nudE homolog 1 - Aspergillus fumigatus (Sartorya fumigata) Length = 621 Score = 31.9 bits (69), Expect = 9.9 Identities = 25/78 (32%), Positives = 34/78 (43%), Gaps = 2/78 (2%) Frame = -1 Query: 322 FGRNQLLDGSISLSPLYPVPTIDCTSESLRSSIRVSPDFDLTRHSS--PSFGSQHLCSER 149 F L +S + P P I +S SLR S+ P F L + S+ SFGS+ L R Sbjct: 256 FSTPTLKTSLMSATATPPSPPISESSSSLRKSMNAMPGFPLQKASASDSSFGSRSLHGSR 315 Query: 148 AFIH*LETRRLGSAKITN 95 H +R A +N Sbjct: 316 TQKHNNHSRATSYAFTSN 333 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 555,532,066 Number of Sequences: 1657284 Number of extensions: 11550470 Number of successful extensions: 25416 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 24770 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25411 length of database: 575,637,011 effective HSP length: 96 effective length of database: 416,537,747 effective search space used: 35405708495 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -