BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0822 (547 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1327.01c ||SPAC1783.09c, SPAC18G6.16c|transcription factor, ... 27 1.4 SPBC4C3.05c |nuc1|rpa1|DNA-directed RNA polymerase I complex lar... 27 1.8 SPAC926.09c |fas1||fatty acid synthase beta subunit Fas1|Schizos... 25 7.3 SPCC297.03 |ssp1||serine/threonine protein kinase Ssp1 |Schizosa... 25 7.3 SPAC2F7.10 |||palmitoyltransferase |Schizosaccharomyces pombe|ch... 25 9.6 SPAPB1A10.13 |||sequence orphan|Schizosaccharomyces pombe|chr 1|... 25 9.6 >SPAC1327.01c ||SPAC1783.09c, SPAC18G6.16c|transcription factor, zf-fungal binuclear cluster type |Schizosaccharomyces pombe|chr 1|||Manual Length = 977 Score = 27.5 bits (58), Expect = 1.4 Identities = 13/46 (28%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = -2 Query: 168 SICAQSAPSFTDW-KRDASGVRKSRT*LDNFILPERTSSVRLHFRY 34 ++C + + + DW +R +SG+++ T + I ER + HF Y Sbjct: 861 ALCDKMSEIWADWVQRTSSGIQEEDTIPNEMIDEERMLDLEKHFMY 906 >SPBC4C3.05c |nuc1|rpa1|DNA-directed RNA polymerase I complex large subunit Nuc1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1689 Score = 27.1 bits (57), Expect = 1.8 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +1 Query: 337 SWRRYKILKQSHPVKRMIRGIGAETTSTYSQ 429 S + YK L Q + VK ++ + +ET S+Y++ Sbjct: 1082 SAKNYKSLIQKYKVKSVLSAVDSETASSYAK 1112 >SPAC926.09c |fas1||fatty acid synthase beta subunit Fas1|Schizosaccharomyces pombe|chr 1|||Manual Length = 2073 Score = 25.0 bits (52), Expect = 7.3 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +3 Query: 432 FKWVRTPAYSNDEAGDL 482 F ++ P YS D+AGDL Sbjct: 443 FSALKVPVYSTDDAGDL 459 >SPCC297.03 |ssp1||serine/threonine protein kinase Ssp1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 652 Score = 25.0 bits (52), Expect = 7.3 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -3 Query: 173 VPAFVLRARLHSLIGNETPRECENH 99 VP FV LH G++TP C H Sbjct: 622 VPGFVSSPNLHLAGGSDTPIYCIEH 646 >SPAC2F7.10 |||palmitoyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 642 Score = 24.6 bits (51), Expect = 9.6 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -2 Query: 537 VHPTAPVLLTKLAHLAPSSDLRLHRSSKP 451 VH +P+L+ L HL S DLR + P Sbjct: 109 VHAASPLLVVYLLHLDISVDLRDDQQHTP 137 >SPAPB1A10.13 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 529 Score = 24.6 bits (51), Expect = 9.6 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = -1 Query: 250 TSESLRSSIRVSPDFDLTRHSSPSFGSQHLCS 155 TS S ++SI S + + HSSPSF + L S Sbjct: 463 TSPSNQASIHASFTKESSTHSSPSFTLESLFS 494 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,260,721 Number of Sequences: 5004 Number of extensions: 46698 Number of successful extensions: 117 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 114 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 117 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 225926624 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -