BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0822 (547 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_03_0177 + 15140414-15140777,15142067-15142239 31 0.79 07_03_1231 + 25047067-25047262,25047876-25048045,25048897-250490... 29 2.4 01_06_1087 - 34430521-34430899,34432336-34432806,34432926-344331... 28 5.6 11_01_0489 + 3776563-3776692,3776995-3777073,3777532-3777840,377... 27 7.4 11_06_0661 - 26009838-26010950,26011302-26011802 27 9.8 06_01_0750 + 5624983-5625173,5626229-5626291,5626421-5626967,562... 27 9.8 >03_03_0177 + 15140414-15140777,15142067-15142239 Length = 178 Score = 30.7 bits (66), Expect = 0.79 Identities = 17/51 (33%), Positives = 29/51 (56%) Frame = -1 Query: 304 LDGSISLSPLYPVPTIDCTSESLRSSIRVSPDFDLTRHSSPSFGSQHLCSE 152 +DG+ + SP P P +DCT+E+L+ + D+ ++PS S+ C E Sbjct: 24 VDGATASSPA-PAPAVDCTAEALK--LADCLDYVTPGKTAPSRPSKLCCGE 71 >07_03_1231 + 25047067-25047262,25047876-25048045,25048897-25049030, 25049122-25049369,25049799-25049904,25049992-25050130, 25050258-25050385,25050472-25050733 Length = 460 Score = 29.1 bits (62), Expect = 2.4 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = -2 Query: 516 LLTKLAHLAPSSDLRLHRSSKPEFSPI 436 +L L +LAP DLR+ SSKP F I Sbjct: 258 MLETLVNLAPVLDLRIFSSSKPSFIKI 284 >01_06_1087 - 34430521-34430899,34432336-34432806,34432926-34433112, 34433470-34433599,34433794-34434125,34434566-34435050, 34435185-34435752,34436579-34436640,34437569-34437636 Length = 893 Score = 27.9 bits (59), Expect = 5.6 Identities = 20/55 (36%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = -1 Query: 433 KFENRLRSFRPQCL*SFALPDETVLKFYIDASYPEGNF-GRNQLLDGSISLSPLY 272 K E LRSF + LP K+ I A++ GN+ GRN GS L L+ Sbjct: 93 KQEETLRSFPDGQRNCYTLPTNRSKKYLIRATFTYGNYDGRNSSESGSPFLFGLH 147 >11_01_0489 + 3776563-3776692,3776995-3777073,3777532-3777840, 3778828-3778898,3778975-3779213,3779306-3779383, 3779734-3780156,3780416-3780661,3780886-3780978, 3781480-3781527 Length = 571 Score = 27.5 bits (58), Expect = 7.4 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +3 Query: 258 IVGTGYRGERLIEPSSSWFRPKFPSG 335 + GTG + PSS+WF P+ SG Sbjct: 14 VFGTGPLPPASLSPSSAWFDPELSSG 39 >11_06_0661 - 26009838-26010950,26011302-26011802 Length = 537 Score = 27.1 bits (57), Expect = 9.8 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -2 Query: 186 HHLSGPSICAQSAPSFTDWK 127 HHL GP+ + S+P WK Sbjct: 297 HHLHGPTSSSSSSPVMASWK 316 >06_01_0750 + 5624983-5625173,5626229-5626291,5626421-5626967, 5627075-5627226,5627317-5627533 Length = 389 Score = 27.1 bits (57), Expect = 9.8 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = -2 Query: 237 YGPPSGFPLTST*PGIV-HHLSGPSICAQSAPSFTDW 130 +GP FP +S+ G HH+ G + A +A S + W Sbjct: 156 HGPVVQFPWSSSASGSAGHHVDGAAAAAATASSASSW 192 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,957,927 Number of Sequences: 37544 Number of extensions: 321300 Number of successful extensions: 678 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 665 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 678 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1222086348 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -