BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0822 (547 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC091125-5|AAK27884.2| 297|Caenorhabditis elegans Hypothetical ... 29 2.9 Z69903-7|CAA93776.1| 1607|Caenorhabditis elegans Hypothetical pr... 27 8.8 Z69660-1|CAA93489.1| 1607|Caenorhabditis elegans Hypothetical pr... 27 8.8 AC024877-7|AAF60907.3| 438|Caenorhabditis elegans Hypothetical ... 27 8.8 >AC091125-5|AAK27884.2| 297|Caenorhabditis elegans Hypothetical protein Y67D2.7 protein. Length = 297 Score = 28.7 bits (61), Expect = 2.9 Identities = 20/94 (21%), Positives = 41/94 (43%), Gaps = 1/94 (1%) Frame = -1 Query: 373 DETVLKFYIDASYPEGNFGRNQLLDGSISLSPLYPVPTIDCTSESLR-SSIRVSPDFDLT 197 +E +L+ ID P GR+ ++D S PT +ES R +++ P ++ Sbjct: 150 NEAILRMNIDEISPSDTPGRDSVVDSPFSAENFDKTPTHQGAAESTREQQLKIPPPPEIE 209 Query: 196 RHSSPSFGSQHLCSERAFIH*LETRRLGSAKITN 95 + + + +H ++A L + G+ + N Sbjct: 210 VNPAIATRFEHAFRQKALGTDLNQQIQGNQQYNN 243 >Z69903-7|CAA93776.1| 1607|Caenorhabditis elegans Hypothetical protein F39B1.1 protein. Length = 1607 Score = 27.1 bits (57), Expect = 8.8 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -2 Query: 537 VHPTAPVLLTKLAHLAPS 484 +HPT PV T L H APS Sbjct: 162 IHPTPPVSSTPLRHSAPS 179 >Z69660-1|CAA93489.1| 1607|Caenorhabditis elegans Hypothetical protein F39B1.1 protein. Length = 1607 Score = 27.1 bits (57), Expect = 8.8 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -2 Query: 537 VHPTAPVLLTKLAHLAPS 484 +HPT PV T L H APS Sbjct: 162 IHPTPPVSSTPLRHSAPS 179 >AC024877-7|AAF60907.3| 438|Caenorhabditis elegans Hypothetical protein Y95B8A.11 protein. Length = 438 Score = 27.1 bits (57), Expect = 8.8 Identities = 17/41 (41%), Positives = 25/41 (60%), Gaps = 2/41 (4%) Frame = +3 Query: 354 NFKTVSSGKAND*RHWGRNDLNLFSNFKWVRTP--AYSNDE 470 NF + S K+N + + +LFS+F+W RTP A SN+E Sbjct: 38 NFSNLESPKSNSSSLF---EDSLFSSFRWKRTPERAPSNNE 75 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,445,417 Number of Sequences: 27780 Number of extensions: 263891 Number of successful extensions: 569 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 552 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 569 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1102518352 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -