BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0821 (655 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC22F3.03c |rdh54|tid1, mug34|ATP-dependent DNA helicase Rdh54... 26 5.5 SPAC1486.10 |thi1|ntf1, SPAC6G10.01|transcription factor Thi1|Sc... 25 7.2 SPCC290.03c |nup186||nucleoporin Nup186|Schizosaccharomyces pomb... 25 7.2 SPBP8B7.30c |thi5||transcription factor Thi5|Schizosaccharomyces... 25 9.5 SPAC6F12.12 |par2|pbp2|protein phosphatase regulatory subunit Pa... 25 9.5 SPAC23H3.02c |ini1||RING finger-like protein Ini1|Schizosaccharo... 25 9.5 >SPAC22F3.03c |rdh54|tid1, mug34|ATP-dependent DNA helicase Rdh54|Schizosaccharomyces pombe|chr 1|||Manual Length = 811 Score = 25.8 bits (54), Expect = 5.5 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 536 WQPSVHSDVVFDPSMS 489 W P H DVV DP +S Sbjct: 187 WDPRTHVDVVIDPFLS 202 >SPAC1486.10 |thi1|ntf1, SPAC6G10.01|transcription factor Thi1|Schizosaccharomyces pombe|chr 1|||Manual Length = 775 Score = 25.4 bits (53), Expect = 7.2 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -3 Query: 539 LWQPSVHSDVVFDPSMSALPI 477 LW+ +HS VVFD S P+ Sbjct: 488 LWKSDLHSSVVFDESAVQHPL 508 >SPCC290.03c |nup186||nucleoporin Nup186|Schizosaccharomyces pombe|chr 3|||Manual Length = 1647 Score = 25.4 bits (53), Expect = 7.2 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = -1 Query: 520 IATLFLILRCRLFLSLRSKIRQALD 446 IATLF +L CRL S+R I +AL+ Sbjct: 617 IATLFELLECRLPDSVRICIVRALE 641 >SPBP8B7.30c |thi5||transcription factor Thi5|Schizosaccharomyces pombe|chr 2|||Manual Length = 857 Score = 25.0 bits (52), Expect = 9.5 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 5/46 (10%) Frame = -1 Query: 163 DFTSR-----VSHSKRETRRRSPFGSRRSMLSVFFLTRASRLRRSG 41 DF+SR + + RRR P SRR + RA ++R SG Sbjct: 5 DFSSRSLFLEAKEEEYKQRRRVPLDSRRRVRRACLSCRAKKIRCSG 50 >SPAC6F12.12 |par2|pbp2|protein phosphatase regulatory subunit Par2|Schizosaccharomyces pombe|chr 1|||Manual Length = 627 Score = 25.0 bits (52), Expect = 9.5 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +2 Query: 566 WHLLIKTLYTKGSIGRAFAVPMRTEH 643 +H + + L GSI FAVP++ EH Sbjct: 398 FHGIAELLEILGSIINGFAVPLKEEH 423 >SPAC23H3.02c |ini1||RING finger-like protein Ini1|Schizosaccharomyces pombe|chr 1|||Manual Length = 117 Score = 25.0 bits (52), Expect = 9.5 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 312 PNVRNCGSSRTEQYYYRNDKPSVG 383 P V N GSSRT+ +Y R + G Sbjct: 86 PRVINLGSSRTDWFYERKKFKNAG 109 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,780,628 Number of Sequences: 5004 Number of extensions: 56556 Number of successful extensions: 144 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 141 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 144 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 295793106 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -