BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0731 (624 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 27 0.15 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 27 0.15 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 27 0.15 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 27 0.15 DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 27 0.15 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 27 0.15 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 23 2.4 DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 23 3.2 DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 23 3.2 DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 23 3.2 DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 23 3.2 U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 22 4.2 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 22 4.2 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 22 4.2 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 22 4.2 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 22 4.2 AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodo... 22 4.2 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 22 5.6 M29488-1|AAA27723.1| 86|Apis mellifera protein ( Bee homeobox-... 21 7.4 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 21 7.4 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 21 7.4 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 21 7.4 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 21 7.4 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 21 7.4 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 21 9.8 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 9.8 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 9.8 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 27.1 bits (57), Expect = 0.15 Identities = 10/26 (38%), Positives = 17/26 (65%), Gaps = 3/26 (11%) Frame = -3 Query: 436 SNTNVDHVCYSFS---RIPLPLPAYY 368 +N N +CY+ + +IP+P+P YY Sbjct: 95 NNNNYKQLCYNINYIEQIPVPVPVYY 120 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 27.1 bits (57), Expect = 0.15 Identities = 10/26 (38%), Positives = 17/26 (65%), Gaps = 3/26 (11%) Frame = -3 Query: 436 SNTNVDHVCYSFS---RIPLPLPAYY 368 +N N +CY+ + +IP+P+P YY Sbjct: 95 NNNNYKQLCYNINYIEQIPVPVPVYY 120 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 27.1 bits (57), Expect = 0.15 Identities = 10/26 (38%), Positives = 17/26 (65%), Gaps = 3/26 (11%) Frame = -3 Query: 436 SNTNVDHVCYSFS---RIPLPLPAYY 368 +N N +CY+ + +IP+P+P YY Sbjct: 95 NNNNYKQLCYNINYIEQIPVPVPVYY 120 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 27.1 bits (57), Expect = 0.15 Identities = 10/26 (38%), Positives = 17/26 (65%), Gaps = 3/26 (11%) Frame = -3 Query: 436 SNTNVDHVCYSFS---RIPLPLPAYY 368 +N N +CY+ + +IP+P+P YY Sbjct: 95 NNNNYKQLCYNINYIEQIPVPVPVYY 120 >DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 27.1 bits (57), Expect = 0.15 Identities = 10/26 (38%), Positives = 17/26 (65%), Gaps = 3/26 (11%) Frame = -3 Query: 436 SNTNVDHVCYSFS---RIPLPLPAYY 368 +N N +CY+ + +IP+P+P YY Sbjct: 95 NNNNYKQLCYNINHIEQIPVPVPVYY 120 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 27.1 bits (57), Expect = 0.15 Identities = 10/26 (38%), Positives = 17/26 (65%), Gaps = 3/26 (11%) Frame = -3 Query: 436 SNTNVDHVCYSFS---RIPLPLPAYY 368 +N N +CY+ + +IP+P+P YY Sbjct: 95 NNNNYKQLCYNINYIEQIPVPVPVYY 120 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 23.0 bits (47), Expect = 2.4 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 8/58 (13%) Frame = +1 Query: 46 FSNKNGSVSKRTASVSQHRTM-----ETS---YLTIPRTVSTVMFLSCSSISLRAEML 195 + NKNGSV TA S T+ E S + +P T+ V+++ + R+ ML Sbjct: 197 YENKNGSVILDTARCSMKWTLIEHAFEISTMLFFVLPMTIIIVLYILIAIKLRRSRML 254 >DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.6 bits (46), Expect = 3.2 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -3 Query: 397 RIPLPLPAYYLIGEFL 350 +IP+P+P YY G FL Sbjct: 117 QIPIPVPVYY--GNFL 130 >DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.6 bits (46), Expect = 3.2 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -3 Query: 397 RIPLPLPAYYLIGEFL 350 +IP+P+P YY G FL Sbjct: 117 QIPIPVPVYY--GNFL 130 >DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.6 bits (46), Expect = 3.2 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -3 Query: 397 RIPLPLPAYYLIGEFL 350 +IP+P+P YY G FL Sbjct: 117 QIPIPVPVYY--GNFL 130 >DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.6 bits (46), Expect = 3.2 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -3 Query: 397 RIPLPLPAYYLIGEFL 350 +IP+P+P YY G FL Sbjct: 117 QIPIPVPVYY--GNFL 130 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 22.2 bits (45), Expect = 4.2 Identities = 6/17 (35%), Positives = 12/17 (70%) Frame = -2 Query: 275 YAELYAVCPVFCEVYLL 225 Y E + + P+FC++Y + Sbjct: 114 YYETWVLGPLFCQIYAM 130 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.2 bits (45), Expect = 4.2 Identities = 9/25 (36%), Positives = 15/25 (60%), Gaps = 3/25 (12%) Frame = -3 Query: 433 NTNVDHVCYSFS---RIPLPLPAYY 368 N N + Y+ + +IP+P+P YY Sbjct: 101 NNNCKKLYYNINYIEQIPIPVPVYY 125 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.2 bits (45), Expect = 4.2 Identities = 9/25 (36%), Positives = 15/25 (60%), Gaps = 3/25 (12%) Frame = -3 Query: 433 NTNVDHVCYSFS---RIPLPLPAYY 368 N N + Y+ + +IP+P+P YY Sbjct: 106 NNNCKKLYYNINYIEQIPIPVPVYY 130 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.2 bits (45), Expect = 4.2 Identities = 9/25 (36%), Positives = 15/25 (60%), Gaps = 3/25 (12%) Frame = -3 Query: 433 NTNVDHVCYSFS---RIPLPLPAYY 368 N N + Y+ + +IP+P+P YY Sbjct: 106 NNNCKKLYYNINYIEQIPIPVPVYY 130 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.2 bits (45), Expect = 4.2 Identities = 9/25 (36%), Positives = 15/25 (60%), Gaps = 3/25 (12%) Frame = -3 Query: 433 NTNVDHVCYSFS---RIPLPLPAYY 368 N N + Y+ + +IP+P+P YY Sbjct: 106 NNNCKKLYYNINYIEQIPIPVPVYY 130 >AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodopsin protein. Length = 152 Score = 22.2 bits (45), Expect = 4.2 Identities = 6/17 (35%), Positives = 12/17 (70%) Frame = -2 Query: 275 YAELYAVCPVFCEVYLL 225 Y E + + P+FC++Y + Sbjct: 80 YYETWVLGPLFCQIYAM 96 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 21.8 bits (44), Expect = 5.6 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 394 IPLPLPAYYLIGEFL 350 +P+P+P YY G FL Sbjct: 115 VPIPVPVYY--GNFL 127 >M29488-1|AAA27723.1| 86|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H55. ). Length = 86 Score = 21.4 bits (43), Expect = 7.4 Identities = 7/20 (35%), Positives = 14/20 (70%) Frame = +1 Query: 52 NKNGSVSKRTASVSQHRTME 111 N NG V ++ S ++++T+E Sbjct: 3 NANGEVKRQRTSYTRYQTLE 22 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.4 bits (43), Expect = 7.4 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = -3 Query: 406 SFSRIPLPLPAYY 368 + +IP+P+P YY Sbjct: 123 NIEQIPVPVPVYY 135 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.4 bits (43), Expect = 7.4 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = -3 Query: 406 SFSRIPLPLPAYY 368 + +IP+P+P YY Sbjct: 123 NIEQIPVPVPVYY 135 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.4 bits (43), Expect = 7.4 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = -3 Query: 406 SFSRIPLPLPAYY 368 + +IP+P+P YY Sbjct: 123 NIEQIPVPVPVYY 135 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 21.4 bits (43), Expect = 7.4 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = -3 Query: 406 SFSRIPLPLPAYY 368 + +IP+P+P YY Sbjct: 348 NIEQIPVPVPVYY 360 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 21.4 bits (43), Expect = 7.4 Identities = 7/18 (38%), Positives = 14/18 (77%) Frame = -2 Query: 107 IVRCWDTEAVLFETLPFL 54 +V C +++++LF + PFL Sbjct: 380 MVHCPESDSILFVSSPFL 397 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.0 bits (42), Expect = 9.8 Identities = 9/43 (20%), Positives = 20/43 (46%) Frame = +2 Query: 296 LVNGKDVSTDVNAVLEHMKEFSDQVVSGQWKGYTGKAITDVIN 424 L NG+ D+ +L+ + +Q S +GY ++ ++ Sbjct: 669 LPNGEGTRADICQLLKDSQYIREQTESDDKEGYLHSVVSGALD 711 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.0 bits (42), Expect = 9.8 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = -1 Query: 624 RIGYRLLCGESLGCYDEQRCLRVQLLQDLSQV 529 ++ ++ G S GC RC+ ++DL +V Sbjct: 133 KVDVEVIGGASRGCTAVLRCVVPSFVKDLVRV 164 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.0 bits (42), Expect = 9.8 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = -1 Query: 624 RIGYRLLCGESLGCYDEQRCLRVQLLQDLSQV 529 ++ ++ G S GC RC+ ++DL +V Sbjct: 133 KVDVEVIGGASRGCTAVLRCVVPSFVKDLVRV 164 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 177,716 Number of Sequences: 438 Number of extensions: 4047 Number of successful extensions: 35 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18582456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -