BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0722 (616 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z72511-9|CAA96661.2| 223|Caenorhabditis elegans Hypothetical pr... 30 1.5 U58753-1|AAC24437.2| 814|Caenorhabditis elegans Hypothetical pr... 29 3.5 >Z72511-9|CAA96661.2| 223|Caenorhabditis elegans Hypothetical protein F55A11.8 protein. Length = 223 Score = 29.9 bits (64), Expect = 1.5 Identities = 19/49 (38%), Positives = 24/49 (48%), Gaps = 4/49 (8%) Frame = -3 Query: 305 QRSGLCSTNITDLNNTACISMNSR---VPNSL-DRYHTDPNVFVRCQEF 171 Q+ L N TD+ N C ++NSR V NS D + P FV Q F Sbjct: 141 QKENLAEMNSTDIINVHCKNLNSRLEHVANSYSDAWKYPPPAFVPSQSF 189 >U58753-1|AAC24437.2| 814|Caenorhabditis elegans Hypothetical protein W03B1.2 protein. Length = 814 Score = 28.7 bits (61), Expect = 3.5 Identities = 16/49 (32%), Positives = 29/49 (59%), Gaps = 1/49 (2%) Frame = -1 Query: 151 LDENKTIF*ITLDILVLCL-VDIFVALFVTHYIYSLYTSSFYFIYFXLD 8 +++++ I+ LDIL+L L +DI +Y +S+ ++FY F LD Sbjct: 79 MEKHEDIYNKALDILLLELNIDIQTLFLKDYYAFSMILAAFYGRKFALD 127 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,681,069 Number of Sequences: 27780 Number of extensions: 220122 Number of successful extensions: 485 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 467 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 485 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1332243108 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -