BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0700 (607 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC093754-1|AAH93754.1| 587|Homo sapiens hypothetical protein LO... 31 4.2 BC093752-1|AAH93752.1| 587|Homo sapiens hypothetical protein LO... 31 4.2 AF131737-1|AAD20026.1| 587|Homo sapiens Unknown protein. 31 4.2 AC079353-1|AAY24034.1| 423|Homo sapiens unknown protein. 31 4.2 U30461-1|AAB52519.1| 554|Homo sapiens GABAA receptor subunit al... 29 9.6 BC035055-1|AAH35055.1| 554|Homo sapiens gamma-aminobutyric acid... 29 9.6 >BC093754-1|AAH93754.1| 587|Homo sapiens hypothetical protein LOC51057 protein. Length = 587 Score = 30.7 bits (66), Expect = 4.2 Identities = 12/44 (27%), Positives = 25/44 (56%) Frame = +1 Query: 7 SVRVPWNPIEGRYGSEREEHRICGGVRILSADLENSGEGCTWRC 138 SVR W+P++ R+G+ ++ +++ +S D E + C + C Sbjct: 120 SVRTEWDPLDVRFGT-KQPYQVFTVEHSVSVDKEPMADSCIYEC 162 >BC093752-1|AAH93752.1| 587|Homo sapiens hypothetical protein LOC51057 protein. Length = 587 Score = 30.7 bits (66), Expect = 4.2 Identities = 12/44 (27%), Positives = 25/44 (56%) Frame = +1 Query: 7 SVRVPWNPIEGRYGSEREEHRICGGVRILSADLENSGEGCTWRC 138 SVR W+P++ R+G+ ++ +++ +S D E + C + C Sbjct: 120 SVRTEWDPLDVRFGT-KQPYQVFTVEHSVSVDKEPMADSCIYEC 162 >AF131737-1|AAD20026.1| 587|Homo sapiens Unknown protein. Length = 587 Score = 30.7 bits (66), Expect = 4.2 Identities = 12/44 (27%), Positives = 25/44 (56%) Frame = +1 Query: 7 SVRVPWNPIEGRYGSEREEHRICGGVRILSADLENSGEGCTWRC 138 SVR W+P++ R+G+ ++ +++ +S D E + C + C Sbjct: 120 SVRTEWDPLDVRFGT-KQPYQVFTVEHSVSVDKEPMADSCIYEC 162 >AC079353-1|AAY24034.1| 423|Homo sapiens unknown protein. Length = 423 Score = 30.7 bits (66), Expect = 4.2 Identities = 12/44 (27%), Positives = 25/44 (56%) Frame = +1 Query: 7 SVRVPWNPIEGRYGSEREEHRICGGVRILSADLENSGEGCTWRC 138 SVR W+P++ R+G+ ++ +++ +S D E + C + C Sbjct: 120 SVRTEWDPLDVRFGT-KQPYQVFTVEHSVSVDKEPMADSCIYEC 162 >U30461-1|AAB52519.1| 554|Homo sapiens GABAA receptor subunit alpha4 protein. Length = 554 Score = 29.5 bits (63), Expect = 9.6 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +3 Query: 492 FRFVRDGTILYDRRSTVSSE 551 FR +R+GTILY R T+S+E Sbjct: 152 FRIMRNGTILYTMRLTISAE 171 >BC035055-1|AAH35055.1| 554|Homo sapiens gamma-aminobutyric acid (GABA) A receptor, alpha 4 protein. Length = 554 Score = 29.5 bits (63), Expect = 9.6 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +3 Query: 492 FRFVRDGTILYDRRSTVSSE 551 FR +R+GTILY R T+S+E Sbjct: 152 FRIMRNGTILYTMRLTISAE 171 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 92,896,446 Number of Sequences: 237096 Number of extensions: 2029376 Number of successful extensions: 5870 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 5439 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5870 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6410414940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -