BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0636 (528 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39045| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 9e-11 SB_41634| Best HMM Match : DUF1518 (HMM E-Value=5.9) 64 9e-11 SB_7830| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_55687| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_44808| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_42131| Best HMM Match : 7tm_1 (HMM E-Value=8.5e-35) 63 2e-10 SB_40798| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_16989| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_12205| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_10006| Best HMM Match : 7tm_1 (HMM E-Value=0.0022) 63 2e-10 SB_7277| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_1811| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_27272| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 2e-10 SB_8963| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 2e-10 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_59787| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_59379| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_59234| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_58491| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_57948| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_56753| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_55151| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 62 4e-10 SB_53500| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_53114| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_52358| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_52245| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_51644| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_51062| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_48779| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_48541| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_48392| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_48030| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_46560| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_46317| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_46148| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_46056| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_46043| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_46002| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_44599| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_44153| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_44091| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 62 4e-10 SB_44051| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_43906| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_42917| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_42078| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_41858| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_41356| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_41249| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_40472| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_39541| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_39402| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_39300| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_38833| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_37911| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_37424| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_37302| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 62 4e-10 SB_37110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 62 4e-10 SB_35268| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_34334| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 62 4e-10 SB_33667| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_33364| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_31814| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_30660| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_30495| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_30006| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_29366| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_27748| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_27084| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_27021| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_26273| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_26100| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_26010| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_25677| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_25546| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_24853| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_24341| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_23921| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_19588| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_19288| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_18833| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_18210| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_18149| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_17336| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_16953| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_15920| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_15774| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_15734| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 62 4e-10 SB_15546| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_15538| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_14422| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_13971| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_12408| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_12224| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_12204| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_11305| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_11121| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_7698| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_6536| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_6174| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_5290| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_4627| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_4362| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_3778| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_1857| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_550| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_527| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 62 4e-10 SB_59314| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 62 4e-10 SB_58870| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_58644| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_58253| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_58116| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_58070| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_57993| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_55314| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_55223| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_54803| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_54229| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_53700| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_53524| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_53359| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_53306| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_53021| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_52780| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) 62 4e-10 SB_51768| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_51582| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_51426| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 62 4e-10 SB_50985| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_50975| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_50881| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_49581| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_49521| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_49109| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_47871| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_46357| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_45833| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_45139| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_44784| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_44724| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_44160| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_42353| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_42008| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_41961| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_41530| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_41130| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_40711| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_40110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 62 4e-10 SB_39956| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_39752| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_39077| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_37493| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_37446| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_37191| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_36226| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_34914| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_34567| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_34080| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_33471| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_31864| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_29675| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_29439| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_29382| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_29170| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_29105| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_28321| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_27775| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_27330| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_26901| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8) 62 4e-10 SB_26760| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_26472| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_26164| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_25733| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_25347| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_24943| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_23689| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_22336| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_22065| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 62 4e-10 SB_21160| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_20762| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_19810| Best HMM Match : Cathelicidins (HMM E-Value=4.8) 62 4e-10 SB_19474| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_19236| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_19110| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_19089| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_18734| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_18260| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_17829| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_17440| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_17175| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_16931| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_14957| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_14500| Best HMM Match : Vicilin_N (HMM E-Value=5.3) 62 4e-10 SB_14440| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_14017| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_13902| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_12263| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_11334| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_10849| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_6814| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_6271| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_5929| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_5657| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_5558| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_5275| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_4697| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_4589| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_4504| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_4388| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_4334| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_3842| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_3072| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_2347| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_2215| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_2183| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_2030| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_1600| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_1514| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_626| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_15901| Best HMM Match : Defensin_1 (HMM E-Value=8.6) 61 5e-10 SB_16792| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 5e-10 SB_11405| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 6e-10 SB_25780| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 8e-10 SB_2991| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 8e-10 SB_5999| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_29399| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_57544| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 3e-09 SB_38201| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_34291| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_37577| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_9828| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_54766| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_46053| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_15129| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_5943| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 3e-05 SB_1430| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 3e-05 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 40 0.001 SB_49932| Best HMM Match : DUF1518 (HMM E-Value=4.9) 38 0.005 SB_44744| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_57731| Best HMM Match : Vicilin_N (HMM E-Value=8.2) 33 0.19 SB_33968| Best HMM Match : Transformer (HMM E-Value=5.1) 33 0.19 SB_22956| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_18142| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.34 SB_57048| Best HMM Match : S-antigen (HMM E-Value=3.4) 31 0.44 SB_10665| Best HMM Match : PT (HMM E-Value=6.2) 31 0.59 SB_11380| Best HMM Match : Cathelicidins (HMM E-Value=9.6) 31 0.78 SB_59705| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_59167| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_59162| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_58689| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_58471| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_58275| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_57695| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_57504| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_57309| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_57160| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_57088| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_57000| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_56985| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_56864| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_56097| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_55911| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_55353| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_54657| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_54057| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_53941| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_53667| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_53456| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_53282| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_53229| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_52843| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_51637| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_51120| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_51074| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_51032| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_51007| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_50996| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_50982| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_50953| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_50936| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_50384| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_50220| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_49746| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_49667| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_49638| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_49552| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_49334| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_49116| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_49113| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_49028| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_48983| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_48970| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_48539| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_48364| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_47957| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_47808| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_47799| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_47505| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_47385| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_47361| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_47000| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_46654| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_46429| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_46359| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_46213| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_45478| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_45234| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_44852| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_44662| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_43993| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_43758| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_43593| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_43340| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_43144| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_43093| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_42443| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_42383| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_42278| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_42126| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_41977| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_40549| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_40449| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_40443| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_40197| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_39975| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_39947| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_39754| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_39490| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_38568| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_38390| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_38374| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_38338| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_38296| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_37924| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_37621| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_37575| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_37514| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_36927| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_36336| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_36111| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_35639| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_35629| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_35549| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_35413| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_35273| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_35215| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_35079| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_34965| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_34867| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_34812| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_34787| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_34475| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_34273| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_34020| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_34019| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_33900| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_33769| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_33633| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_33363| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_33156| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_33065| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_32699| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_32249| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_31827| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_31689| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_31560| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_31456| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_31442| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_31298| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_31283| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_31155| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_31061| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_30878| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_29626| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_29443| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_28945| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_28854| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_28678| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_28435| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_27859| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_27744| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_27595| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_27513| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_27344| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_26541| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_26180| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_26102| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_26045| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_25987| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_25886| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_24955| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_24149| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_24008| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_23901| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_23701| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_23491| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_23324| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_23308| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_23301| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_23277| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_22929| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_22744| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_22512| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_22481| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_22451| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_21947| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_21159| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_21030| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_20944| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_20880| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_20832| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_20742| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_20690| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_20420| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_20060| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_20036| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_19743| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_19490| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_19448| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_19196| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_18813| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_18603| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_18478| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_18315| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_17938| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_17616| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_17417| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_17352| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_17230| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_16690| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_16230| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_15921| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_15429| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_15370| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_14040| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_13724| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_13500| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_12864| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_12842| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_12053| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_12049| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_11704| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_11587| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_10981| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_10838| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_10043| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_9790| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_9789| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_9564| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_9236| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_9227| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_9169| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_8778| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_8203| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_8131| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_7699| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_7316| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_7204| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_6994| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_6265| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_6232| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_6109| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_6103| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_5995| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_5987| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_5937| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_5666| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_5533| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_4915| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_4853| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_4538| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_4213| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_4133| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_3630| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_3555| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_3396| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_3272| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_3008| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_2936| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_2741| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_2242| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_1859| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_1767| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_1708| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_1630| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_1626| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_1413| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_1202| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_1184| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_620| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_597| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_141| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_59761| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_59213| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_59171| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 >SB_39045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 63.7 bits (148), Expect = 9e-11 Identities = 31/58 (53%), Positives = 37/58 (63%), Gaps = 1/58 (1%) Frame = -2 Query: 173 RPGTGRIRFPS-KPDTPRSSEPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 RP GR+ + + EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 20 RPAPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 77 >SB_41634| Best HMM Match : DUF1518 (HMM E-Value=5.9) Length = 321 Score = 63.7 bits (148), Expect = 9e-11 Identities = 31/55 (56%), Positives = 36/55 (65%) Frame = -2 Query: 167 GTGRIRFPSKPDTPRSSEPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 G G + P P + EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 238 GPGPLASSLSPTDP-TLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 291 >SB_7830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 62.9 bits (146), Expect = 2e-10 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -2 Query: 125 RSSEPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 +S EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_55687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 62.9 bits (146), Expect = 2e-10 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -2 Query: 125 RSSEPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 +S EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_44808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 62.9 bits (146), Expect = 2e-10 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -2 Query: 125 RSSEPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 +S EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_42131| Best HMM Match : 7tm_1 (HMM E-Value=8.5e-35) Length = 521 Score = 62.9 bits (146), Expect = 2e-10 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -1 Query: 507 SEHWAEITLRQHPRGPSQCFVLIRQSDSPCPCQF 406 +EHWAEITLRQH PSQCFVLI+QSDSP CQF Sbjct: 49 NEHWAEITLRQHRFRPSQCFVLIKQSDSPSHCQF 82 >SB_40798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 62.9 bits (146), Expect = 2e-10 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -2 Query: 125 RSSEPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 +S EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_16989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 62.9 bits (146), Expect = 2e-10 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -2 Query: 125 RSSEPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 +S EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_12205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 62.9 bits (146), Expect = 2e-10 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -2 Query: 125 RSSEPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 +S EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_10006| Best HMM Match : 7tm_1 (HMM E-Value=0.0022) Length = 309 Score = 62.9 bits (146), Expect = 2e-10 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -2 Query: 125 RSSEPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 +S EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_7277| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 62.9 bits (146), Expect = 2e-10 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -2 Query: 125 RSSEPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 +S EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_1811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 62.9 bits (146), Expect = 2e-10 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -2 Query: 125 RSSEPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 +S EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_27272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 62.5 bits (145), Expect = 2e-10 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL+PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 28 EPILLPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 65 >SB_8963| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 62.5 bits (145), Expect = 2e-10 Identities = 29/41 (70%), Positives = 32/41 (78%) Frame = -1 Query: 126 PVLRANPYSEVTDPICRLPLPTLF*RLEALHHGDLLRIXVR 4 P LRANP+ EVTD CRLPLPTLF + EA H GDLLR+ VR Sbjct: 77 PTLRANPFPEVTDLFCRLPLPTLFYQPEAAHLGDLLRLLVR 117 >SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 62.1 bits (144), Expect = 3e-10 Identities = 28/45 (62%), Positives = 32/45 (71%) Frame = -2 Query: 137 PDTPRSSEPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 P + EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 84 PRQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 128 >SB_59787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 65 >SB_59379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_59234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_58491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_57948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 65 >SB_56753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_55151| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 402 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 178 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 215 >SB_53500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 77 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 114 >SB_53114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_52358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_52245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_51644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 65 >SB_51062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_48779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_48541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_48392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_48030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 77 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 114 >SB_46560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_46317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 65 >SB_46148| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_46056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_46043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_46002| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_44599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 40 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 77 >SB_44153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_44091| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 112 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 149 >SB_44051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_43906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 65 >SB_42917| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_42078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 40 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 77 >SB_41858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_41356| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_41249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_40472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_39541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_39402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 34 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 71 >SB_39300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_38833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_37911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_37424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_37302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_37110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 112 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 149 >SB_35268| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 40 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 77 >SB_34334| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 112 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 149 >SB_33667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 65 >SB_33364| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_31814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_30660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_30495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_30006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 65 >SB_29366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_27748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 65 >SB_27084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_27021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_26273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_26100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 46 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 83 >SB_26010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_25677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_25546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 40 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 77 >SB_24853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_24341| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_23921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_19588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_19288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_18833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_18210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_18149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 40 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 77 >SB_17336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 65 >SB_16953| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 65 >SB_15920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_15774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_15734| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 248 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 181 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 218 >SB_15546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_15538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 65 >SB_14422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_13971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_12408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_12224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_12204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_11305| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_11121| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 49 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 86 >SB_7698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 77 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 114 >SB_6536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_6174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 40 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 77 >SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 77 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 114 >SB_5290| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = -2 Query: 125 RSSEPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 +S +PIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 36 QSLDPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_4627| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_4362| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_3778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 65 >SB_1857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_527| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 218 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 151 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 188 >SB_59314| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 112 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 149 >SB_58870| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_58644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_58253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_58116| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_58070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 111 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 148 >SB_57993| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_55314| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_55223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_54803| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_54229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_53700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_53524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_53359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 65 >SB_53306| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 65 >SB_53021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_52780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 65 >SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) Length = 782 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 734 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 771 >SB_51768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 65 >SB_51582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 65 >SB_51426| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 112 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 149 >SB_50985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_50975| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 65 >SB_50881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 40 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 77 >SB_49581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_49521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 65 >SB_49109| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_47871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 65 >SB_46357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_45833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_45139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_44784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_44724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_44160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 60 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 97 >SB_42353| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_42008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 65 >SB_41961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_41530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 261 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_41130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 65 >SB_40711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 65 >SB_40110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 217 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 150 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 187 >SB_39956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 65 >SB_39752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 65 >SB_39077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_37493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 65 >SB_37446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 46 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 83 >SB_37191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_36226| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 65 >SB_34914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_34567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_34080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 65 >SB_33471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 65 >SB_31864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 65 >SB_29675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_29439| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 65 >SB_29382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_29170| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_29105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_28321| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_27775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_27330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 65 >SB_26901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 65 >SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8) Length = 411 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 191 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 228 >SB_26760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_26472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_26164| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_25733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_25347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_24943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_23689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 65 >SB_22336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 65 >SB_22065| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 217 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 150 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 187 >SB_21160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 65 >SB_20762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 65 >SB_19810| Best HMM Match : Cathelicidins (HMM E-Value=4.8) Length = 204 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 137 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 174 >SB_19474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_19236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_19110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 65 >SB_19089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 77 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 114 >SB_18734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 65 >SB_18260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_17829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_17440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 65 >SB_17175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_16931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_14957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_14500| Best HMM Match : Vicilin_N (HMM E-Value=5.3) Length = 237 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_14440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 65 >SB_14017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_13902| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_12263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 65 >SB_11334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_10849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_6814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_6271| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_5929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_5657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_5558| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 78 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 115 >SB_5275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_4697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_4589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_4504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 78 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 115 >SB_4388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 77 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 114 >SB_4334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 65 >SB_3842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 65 >SB_3072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_2347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_2215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_2183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_2030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_1600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_1514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_15901| Best HMM Match : Defensin_1 (HMM E-Value=8.6) Length = 106 Score = 61.3 bits (142), Expect = 5e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLHTLETCCGYEYD 76 >SB_16792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 61.3 bits (142), Expect = 5e-10 Identities = 28/53 (52%), Positives = 35/53 (66%) Frame = -2 Query: 161 GRIRFPSKPDTPRSSEPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 GR+ + + +PIL PKLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 23 GRVHWLQVSARQTNLKPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 75 >SB_11405| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.9 bits (141), Expect = 6e-10 Identities = 27/37 (72%), Positives = 29/37 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXY 6 EPIL PKLRI FADF YLH S + RL T+ETCCGY Y Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEY 75 >SB_25780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.5 bits (140), Expect = 8e-10 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = -2 Query: 125 RSSEPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 +S EPIL KLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 36 QSKEPILFSKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_2991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 60.5 bits (140), Expect = 8e-10 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH + + RL T+ETCCGY Y+ Sbjct: 52 EPILFPKLRIYFADFPYLHCAINQRLLTLETCCGYEYD 89 >SB_5999| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 1e-09 Identities = 26/38 (68%), Positives = 29/38 (76%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI F DF YLH S + RL T+ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFVDFPYLHCSINQRLLTLETCCGYEYD 76 >SB_29399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 59.7 bits (138), Expect = 1e-09 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = -2 Query: 125 RSSEPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 +S EPIL KLRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 36 QSLEPILFSKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_57544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.3 bits (137), Expect = 2e-09 Identities = 26/38 (68%), Positives = 29/38 (76%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 EPIL PKLRI FADF YLH S + RL +ETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLKLETCCGYEYD 76 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 58.4 bits (135), Expect = 3e-09 Identities = 27/37 (72%), Positives = 29/37 (78%) Frame = -1 Query: 126 PVLRANPYSEVTDPICRLPLPTLF*RLEALHHGDLLR 16 P LRANP+ EVTD CRLPLPTLF + EA H GDLLR Sbjct: 37 PTLRANPFPEVTDLFCRLPLPTLFYQPEAAHLGDLLR 73 >SB_38201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 50.8 bits (116), Expect = 7e-07 Identities = 24/49 (48%), Positives = 31/49 (63%) Frame = -2 Query: 149 FPSKPDTPRSSEPILIPKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 F ++ P + P +LRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 1 FSARQTQPLEANPFS-RRLRIYFADFPYLHCSINQRLLTLETCCGYEYD 48 >SB_34291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 49.2 bits (112), Expect = 2e-06 Identities = 21/31 (67%), Positives = 24/31 (77%) Frame = -2 Query: 95 LRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 LRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 1 LRIYFADFPYLHVSINQRLLTLETCCGYEYD 31 >SB_37577| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 48.8 bits (111), Expect = 3e-06 Identities = 21/31 (67%), Positives = 24/31 (77%) Frame = -2 Query: 95 LRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 LRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 1 LRIYFADFPYLHCSINQRLLTLETCCGYEYD 31 >SB_9828| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 48.8 bits (111), Expect = 3e-06 Identities = 21/31 (67%), Positives = 24/31 (77%) Frame = -2 Query: 95 LRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 LRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 1 LRIYFADFPYLHCSINQRLLTLETCCGYEYD 31 >SB_54766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 48.8 bits (111), Expect = 3e-06 Identities = 21/31 (67%), Positives = 24/31 (77%) Frame = -2 Query: 95 LRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 LRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 2 LRIYFADFPYLHCSINQRLLTLETCCGYEYD 32 >SB_46053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 48.8 bits (111), Expect = 3e-06 Identities = 21/31 (67%), Positives = 24/31 (77%) Frame = -2 Query: 95 LRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 LRI FADF YLH S + RL T+ETCCGY Y+ Sbjct: 1 LRIYFADFPYLHCSINQRLLTLETCCGYEYD 31 >SB_15129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 45.6 bits (103), Expect = 3e-05 Identities = 19/29 (65%), Positives = 22/29 (75%) Frame = -2 Query: 89 IQFADFLYLHYSND*RLFTMETCCGYXYE 3 I FADF YLH S + RL T+ETCCGY Y+ Sbjct: 4 IYFADFPYLHVSINQRLLTLETCCGYEYD 32 >SB_5943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 45.2 bits (102), Expect = 3e-05 Identities = 19/29 (65%), Positives = 22/29 (75%) Frame = -2 Query: 89 IQFADFLYLHYSND*RLFTMETCCGYXYE 3 I FADF YLH S + RL T+ETCCGY Y+ Sbjct: 10 IYFADFPYLHCSINQRLLTLETCCGYEYD 38 >SB_1430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 45.2 bits (102), Expect = 3e-05 Identities = 19/33 (57%), Positives = 24/33 (72%) Frame = -2 Query: 101 PKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 P++ FADF YLH S + RL T+ETCCGY Y+ Sbjct: 45 PEVTDLFADFPYLHCSINQRLLTLETCCGYEYD 77 Score = 27.1 bits (57), Expect = 9.6 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -1 Query: 126 PVLRANPYSEVTDPICRLP 70 P LRANP+ EVTD P Sbjct: 37 PTLRANPFPEVTDLFADFP 55 >SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) Length = 174 Score = 39.9 bits (89), Expect = 0.001 Identities = 21/35 (60%), Positives = 24/35 (68%), Gaps = 2/35 (5%) Frame = -2 Query: 116 EPILIPKLRIQFADFLYLHYSND*RLF--TMETCC 18 EPIL PKLRI FADF YLH S + RL +E+ C Sbjct: 52 EPILFPKLRIYFADFPYLHCSINQRLLGDPLESTC 86 >SB_49932| Best HMM Match : DUF1518 (HMM E-Value=4.9) Length = 276 Score = 37.9 bits (84), Expect = 0.005 Identities = 16/33 (48%), Positives = 21/33 (63%) Frame = -2 Query: 101 PKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 P++ F YLH S + RL T+ETCCGY Y+ Sbjct: 149 PEVTDLFCRLPYLHCSINQRLLTLETCCGYEYD 181 Score = 35.1 bits (77), Expect = 0.036 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -1 Query: 126 PVLRANPYSEVTDPICRLP 70 P LRANP+ EVTD CRLP Sbjct: 141 PTLRANPFPEVTDLFCRLP 159 >SB_44744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 36.7 bits (81), Expect = 0.012 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 126 PVLRANPYSEVTDPICRLPL 67 P LRANP+ EVTD CRLPL Sbjct: 37 PTLRANPFPEVTDLFCRLPL 56 Score = 34.7 bits (76), Expect = 0.048 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = -2 Query: 101 PKLRIQFADFLYLHYSND*RLFTMETCCGYXYE 3 P++ F LH S + RL T+ETCCGY Y+ Sbjct: 45 PEVTDLFCRLPLLHCSINQRLLTLETCCGYEYD 77 >SB_57731| Best HMM Match : Vicilin_N (HMM E-Value=8.2) Length = 196 Score = 32.7 bits (71), Expect = 0.19 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -2 Query: 149 FPSKPDTPRSSEPILIPKLRIQFADFLYLHYSN-D*RLFTMETCCGYXYE 3 +P + SS +L K I A + +H N + RL T+ETCCGY Y+ Sbjct: 38 YPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQNQRLLTLETCCGYEYD 87 >SB_33968| Best HMM Match : Transformer (HMM E-Value=5.1) Length = 471 Score = 32.7 bits (71), Expect = 0.19 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -2 Query: 149 FPSKPDTPRSSEPILIPKLRIQFADFLYLHYSN-D*RLFTMETCCGYXYE 3 +P + SS +L K I A + +H N + RL T+ETCCGY Y+ Sbjct: 76 YPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENHNQRLLTLETCCGYEYD 125 >SB_22956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 32.7 bits (71), Expect = 0.19 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -2 Query: 149 FPSKPDTPRSSEPILIPKLRIQFADFLYLHYSN-D*RLFTMETCCGYXYE 3 +P + SS +L K I A + +H N + RL T+ETCCGY Y+ Sbjct: 38 YPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQNQRLLTLETCCGYEYD 87 >SB_18142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 31.9 bits (69), Expect = 0.34 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -2 Query: 44 RLFTMETCCGYXY 6 RLFT+ETCCGY Y Sbjct: 1 RLFTLETCCGYEY 13 >SB_57048| Best HMM Match : S-antigen (HMM E-Value=3.4) Length = 242 Score = 31.5 bits (68), Expect = 0.44 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = -1 Query: 186 TNIDQTRHRPHPLPVQTRHAPVLRA--NPYSEVTDP 85 T+ QT+HRPH P QT H P P+ TDP Sbjct: 167 TDPTQTQHRPHTDPTQTPHGPHTDPTWTPHRPNTDP 202 Score = 31.1 bits (67), Expect = 0.59 Identities = 18/41 (43%), Positives = 23/41 (56%), Gaps = 4/41 (9%) Frame = -1 Query: 195 T*RTNID--QTRHRPHPLPVQTRHAPVL--RANPYSEVTDP 85 T RT+ D QT+HRP+ P QT+H P P+ TDP Sbjct: 151 TTRTHTDPTQTQHRPNTDPTQTQHRPHTDPTQTPHGPHTDP 191 >SB_10665| Best HMM Match : PT (HMM E-Value=6.2) Length = 215 Score = 31.1 bits (67), Expect = 0.59 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = -1 Query: 186 TNIDQTRHRPHPLPVQTRHAP--VLRANPYSEVTDP 85 T+ +TRH PH P +TRH P P+ TDP Sbjct: 23 TDPTRTRHGPHTDPTRTRHGPHTDTTRTPHGHDTDP 58 Score = 31.1 bits (67), Expect = 0.59 Identities = 16/36 (44%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Frame = -1 Query: 186 TNIDQTRHRPHPLPVQTRHAPVLRA--NPYSEVTDP 85 TN QT+H PH P QT H P P+ TDP Sbjct: 111 TNPTQTQHGPHTNPTQTPHGPHTDPTWTPHRPNTDP 146 Score = 27.1 bits (57), Expect = 9.6 Identities = 12/24 (50%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -1 Query: 189 RTNIDQTR--HRPHPLPVQTRHAP 124 R ++D TR HRPH P +T H P Sbjct: 163 RPHMDPTRTPHRPHMDPTRTSHGP 186 >SB_11380| Best HMM Match : Cathelicidins (HMM E-Value=9.6) Length = 149 Score = 30.7 bits (66), Expect = 0.78 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -2 Query: 59 YSND*RLFTMETCCGYXYE 3 + + RL T+ETCCGY Y+ Sbjct: 101 FDTESRLLTLETCCGYEYD 119 >SB_59705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 30.3 bits (65), Expect = 1.0 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -2 Query: 44 RLFTMETCCGYXYE 3 RL T+ETCCGY Y+ Sbjct: 1 RLLTLETCCGYEYD 14 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,952,929 Number of Sequences: 59808 Number of extensions: 355040 Number of successful extensions: 1900 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 1766 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1891 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1197191618 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -