BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0636 (528 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 26 0.27 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 26 0.27 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 26 0.27 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 26 0.27 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 26 0.27 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 26 0.27 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 24 0.84 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 23 1.9 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 23 1.9 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 23 1.9 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 23 1.9 DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 23 2.6 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 23 2.6 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 23 2.6 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 23 2.6 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 23 2.6 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 23 2.6 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 21 5.9 AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 21 5.9 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 21 7.8 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 21 7.8 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 7.8 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 25.8 bits (54), Expect = 0.27 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 382 RTESCRSRTKRNRHDLRLGRSAEGRRTRVRIQS 284 RT SC SR + +RH+ R +G R+ R +S Sbjct: 226 RTSSCHSRYEDSRHEDRNSYRNDGERSCSRDRS 258 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 25.8 bits (54), Expect = 0.27 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 382 RTESCRSRTKRNRHDLRLGRSAEGRRTRVRIQS 284 RT SC SR + +RH+ R +G R+ R +S Sbjct: 226 RTSSCHSRYEDSRHEDRNSYRNDGERSCSRDRS 258 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 25.8 bits (54), Expect = 0.27 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 382 RTESCRSRTKRNRHDLRLGRSAEGRRTRVRIQS 284 RT SC SR + +RH+ R +G R+ R +S Sbjct: 226 RTSSCHSRYEDSRHEDRNSYRNDGERSCSRDRS 258 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 25.8 bits (54), Expect = 0.27 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 382 RTESCRSRTKRNRHDLRLGRSAEGRRTRVRIQS 284 RT SC SR + +RH+ R +G R+ R +S Sbjct: 226 RTSSCHSRYEDSRHEDRNSYRNDGERSCSRDRS 258 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 25.8 bits (54), Expect = 0.27 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 382 RTESCRSRTKRNRHDLRLGRSAEGRRTRVRIQS 284 RT SC SR + +RH+ R +G R+ R +S Sbjct: 226 RTSSCHSRYEDSRHEDRNSYRNDGERSCSRDRS 258 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 25.8 bits (54), Expect = 0.27 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 382 RTESCRSRTKRNRHDLRLGRSAEGRRTRVRIQS 284 RT SC SR + +RH+ R +G R+ R +S Sbjct: 226 RTSSCHSRYEDSRHEDRNSYRNDGERSCSRDRS 258 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 24.2 bits (50), Expect = 0.84 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -3 Query: 382 RTESCRSRTKRNRHDLRLGRSAEGRRTRVRIQS 284 RT SC SR + RH+ R +G R+ R +S Sbjct: 226 RTSSCHSRYEDLRHEDRNSYRNDGERSCSRDRS 258 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.0 bits (47), Expect = 1.9 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -3 Query: 382 RTESCRSRTKRNRHDLRLGRSAEGRRTRVRIQS 284 RT SC SR + +RH+ +G R+ R +S Sbjct: 226 RTSSCHSRYEDSRHEDGNSYRNDGERSCSRDRS 258 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 23.0 bits (47), Expect = 1.9 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = -2 Query: 371 VPIAHETKPTRLTARKIRGRPENAGPDPVRNVRR 270 VPI TKP AR +G N G + V V++ Sbjct: 292 VPIDANTKPCTWAARPWQGYMTNNGVNNVEAVQK 325 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 23.0 bits (47), Expect = 1.9 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = -2 Query: 371 VPIAHETKPTRLTARKIRGRPENAGPDPVRNVRR 270 VPI TKP AR +G N G + V V++ Sbjct: 292 VPIDANTKPCTWAARPWQGYMTNNGVNNVEAVQK 325 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 23.0 bits (47), Expect = 1.9 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = -2 Query: 371 VPIAHETKPTRLTARKIRGRPENAGPDPVRNVRR 270 VPI TKP AR +G N G + V V++ Sbjct: 292 VPIDANTKPCTWAARPWQGYMTNNGVNNVEAVQK 325 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.6 bits (46), Expect = 2.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = -2 Query: 164 TGRIRFPSKPDTPRSSEPILIPKLRIQFADFLYLHYSND 48 T R R + + RS EP +I L + Y +Y+N+ Sbjct: 62 TSRERSRDRKERERSKEPKIISSLSNNYKYSNYNNYNNN 100 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.6 bits (46), Expect = 2.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = -2 Query: 164 TGRIRFPSKPDTPRSSEPILIPKLRIQFADFLYLHYSND 48 T R R + + RS EP +I L + Y +Y+N+ Sbjct: 62 TSRERSRDRKERERSKEPKIISSLSNNYKYSNYNNYNNN 100 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.6 bits (46), Expect = 2.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = -2 Query: 164 TGRIRFPSKPDTPRSSEPILIPKLRIQFADFLYLHYSND 48 T R R + + RS EP +I L + Y +Y+N+ Sbjct: 62 TSRERSRDRKERERSKEPKIISSLSNNYKYSNYNNYNNN 100 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.6 bits (46), Expect = 2.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = -2 Query: 164 TGRIRFPSKPDTPRSSEPILIPKLRIQFADFLYLHYSND 48 T R R + + RS EP +I L + Y +Y+N+ Sbjct: 62 TSRERSRDRKERERSKEPKIISSLSNNYKYSNYNNYNNN 100 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 22.6 bits (46), Expect = 2.6 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 148 KRMRPVPGLVDVRALCSF*RVSILI*CGLKNCI 246 K +RPV DV +C ++S LI LKN I Sbjct: 42 KLVRPVVNTSDVLRVCIKLKLSQLIDVNLKNQI 74 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 22.6 bits (46), Expect = 2.6 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 148 KRMRPVPGLVDVRALCSF*RVSILI*CGLKNCI 246 K +RPV DV +C ++S LI LKN I Sbjct: 42 KLVRPVVNTSDVLRVCIKLKLSQLIDVNLKNQI 74 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 21.4 bits (43), Expect = 5.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 164 TGRIRFPSKPDTPRSSEPILIPKLRIQFADFLYLHYSND 48 T + R + + RS EP +I L + Y +Y+N+ Sbjct: 295 TSKERSRDRTERERSKEPKIISSLSNNYKYSNYNNYNNN 333 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 21.4 bits (43), Expect = 5.9 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = -2 Query: 395 VERRSYRIVPIAHETKPTRLTARKIRGRPEN 303 VE + Y+ V I+ T+P+ T + P N Sbjct: 183 VEEQRYKQVEISQMTEPSSSTKSYVLEGPRN 213 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 21.0 bits (42), Expect = 7.8 Identities = 11/38 (28%), Positives = 18/38 (47%) Frame = -2 Query: 164 TGRIRFPSKPDTPRSSEPILIPKLRIQFADFLYLHYSN 51 T + R + + RS EP +I L + Y +Y+N Sbjct: 62 TSKERSRDRKERERSKEPKIISSLSNNYKYSNYNNYNN 99 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.0 bits (42), Expect = 7.8 Identities = 11/38 (28%), Positives = 18/38 (47%) Frame = -2 Query: 164 TGRIRFPSKPDTPRSSEPILIPKLRIQFADFLYLHYSN 51 T + R + + RS EP +I L + Y +Y+N Sbjct: 295 TSKERSRDRKERERSKEPKIISSLSNNYKYSNYNNYNN 332 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.0 bits (42), Expect = 7.8 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = -1 Query: 159 PHPLPVQTRHAPVLRANPYSEV 94 P PLP A + + +PYS + Sbjct: 652 PFPLPPNLASANISQLDPYSSL 673 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,451 Number of Sequences: 438 Number of extensions: 3276 Number of successful extensions: 31 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14845611 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -