BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0636 (528 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g76965.1 68414.m08961 glycine-rich protein 29 1.5 At5g37380.2 68418.m04492 DNAJ heat shock N-terminal domain-conta... 27 7.8 At5g37380.1 68418.m04491 DNAJ heat shock N-terminal domain-conta... 27 7.8 At2g44900.1 68415.m05589 armadillo/beta-catenin repeat family pr... 27 7.8 >At1g76965.1 68414.m08961 glycine-rich protein Length = 158 Score = 29.5 bits (63), Expect = 1.5 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -2 Query: 170 PGTGRIRFPSKPDTPRSSEPILIPKLRIQFAD 75 PG + FP KP+ P P +P+L + F D Sbjct: 93 PGAAIVVFPKKPEEPVKVVPTPMPQLNLFFGD 124 >At5g37380.2 68418.m04492 DNAJ heat shock N-terminal domain-containing protein similar to SP|Q9QYI4 DnaJ homolog subfamily B member 12 {Mus musculus}; contains Pfam profile PF00226: DnaJ domain Length = 431 Score = 27.1 bits (57), Expect = 7.8 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = -1 Query: 210 NSLKRT*RTNIDQTRHRPHPLPVQTRHAPVLRANPYSEVTDP 85 N K T TN T R +P P Q + P + NP ++ T+P Sbjct: 150 NFAKTTFTTNARTTTPRNNP-PAQKTNPPAQKTNPPAQKTNP 190 >At5g37380.1 68418.m04491 DNAJ heat shock N-terminal domain-containing protein similar to SP|Q9QYI4 DnaJ homolog subfamily B member 12 {Mus musculus}; contains Pfam profile PF00226: DnaJ domain Length = 431 Score = 27.1 bits (57), Expect = 7.8 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = -1 Query: 210 NSLKRT*RTNIDQTRHRPHPLPVQTRHAPVLRANPYSEVTDP 85 N K T TN T R +P P Q + P + NP ++ T+P Sbjct: 150 NFAKTTFTTNARTTTPRNNP-PAQKTNPPAQKTNPPAQKTNP 190 >At2g44900.1 68415.m05589 armadillo/beta-catenin repeat family protein / F-box family protein contains similarity to F-box protein FBL2 GI:6010699 from [Rattus norvegicus]; contains Pfam profiles PF00514: Armadillo/beta-catenin-like repeat, PF00646: F-box domain Length = 930 Score = 27.1 bits (57), Expect = 7.8 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = -2 Query: 146 PSKPDTPRSSEPILI-PKLRIQFADFLYLHYSND*RLFT 33 PS P+T S+E L+ P+L F D++ L Y +LFT Sbjct: 22 PSYPETSISNEEDLVAPELLHGFVDWISLPYDTVLQLFT 60 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,551,806 Number of Sequences: 28952 Number of extensions: 234045 Number of successful extensions: 682 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 662 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 682 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 977150592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -