BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0635 (528 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|c... 29 0.43 SPBC725.11c |php2||CCAAT-binding factor complex subunit Php2 |Sc... 27 1.7 SPAC30D11.01c ||SPAC56F8.01|alpha-glucosidase|Schizosaccharomyce... 27 2.3 SPCC970.08 |||inositol polyphosphate kinase |Schizosaccharomyces... 26 4.0 SPAC23A1.09 |||RNA-binding protein|Schizosaccharomyces pombe|chr... 26 4.0 SPCC1393.04 |fta4|sma6|Sim4 and Mal2 associated |Schizosaccharom... 25 5.3 SPCC11E10.03 |mug1||dynactin complex subunit |Schizosaccharomyce... 25 5.3 SPBC106.01 |mph1|SPBC1271.16c, SPBC243.01|dual specificity prote... 25 5.3 SPAC3A12.05c |taf2||TATA-binding protein associated factor Taf2|... 25 5.3 SPCP31B10.07 |eft202||translation elongation factor 2 |Schizosac... 25 7.0 SPCC777.02 |||transcription factor |Schizosaccharomyces pombe|ch... 25 7.0 SPAC513.01c |eft201|eft2-1, etf2, SPAPYUK71.04c|translation elon... 25 7.0 SPBC16G5.15c |fkh2||fork head transcription factor Fkh2 |Schizos... 25 9.2 SPBC32H8.07 |git5|gpb1|heterotrimeric G protein beta subunit Git... 25 9.2 >SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1142 Score = 29.1 bits (62), Expect = 0.43 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +1 Query: 433 SGCGRCRVWSMFVRYVRFSE 492 +GCG+ VW +VR+V F E Sbjct: 108 NGCGKSYVWPSYVRFVDFDE 127 >SPBC725.11c |php2||CCAAT-binding factor complex subunit Php2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 334 Score = 27.1 bits (57), Expect = 1.7 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +1 Query: 160 PWNPIEGRYGSEREEHRICGGVRILSADLENSVRDVRGDVAP 285 P+ P+EG Y + ++ HRI R A LE +R V+ P Sbjct: 3 PYEPVEGLYVNAKQYHRILKR-REARAKLEERLRGVQTTKKP 43 >SPAC30D11.01c ||SPAC56F8.01|alpha-glucosidase|Schizosaccharomyces pombe|chr 1|||Manual Length = 993 Score = 26.6 bits (56), Expect = 2.3 Identities = 18/80 (22%), Positives = 41/80 (51%), Gaps = 6/80 (7%) Frame = -2 Query: 440 HPLPVQTRHAPVLRANPYSEVTDPICRLPLPTLFYRLEALH-----LGDLLRIWVRTGAT 276 HP ++ R+ P+ N Y+ + + L + L + + +G ++ ++V +G+T Sbjct: 254 HPFYMEQRYIPIGTTNTYTSASHGVLMLSSNGMEVLLRSTYIKYRMIGGIIDLFVYSGST 313 Query: 275 -SPRTSLTEFSRSAESIRTP 219 SP+ ++ ++ +SI TP Sbjct: 314 VSPKYTIQQY---VQSIGTP 330 >SPCC970.08 |||inositol polyphosphate kinase |Schizosaccharomyces pombe|chr 3|||Manual Length = 967 Score = 25.8 bits (54), Expect = 4.0 Identities = 21/70 (30%), Positives = 33/70 (47%) Frame = -1 Query: 372 SNLPTSLTYIILSTRGSSPWRPAADMGTNRRDISTYIPHRIFKVRREYPDTAANAVLFAF 193 S TSL+ R S+P R D G+++ +TYIPH K ++ +A Sbjct: 212 SEKDTSLSRRSSRGRSSAPKR-RKDSGSSKTT-ATYIPHNPSKKSSQHLPLLPDASFELE 269 Query: 192 RTISPFYRIP 163 R++S Y+ P Sbjct: 270 RSVSRSYQSP 279 >SPAC23A1.09 |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 121 Score = 25.8 bits (54), Expect = 4.0 Identities = 16/47 (34%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = -2 Query: 212 MRCSSRSEPYLPSI-GFHGTRTLRQKRKLFPDLSAASSGHFGLPRRT 75 MR + E Y+ + G H T Q LF D + H L RRT Sbjct: 1 MRPAKSVEGYIIIVTGVHPEATEEQVEDLFADFGPVKNLHLNLDRRT 47 >SPCC1393.04 |fta4|sma6|Sim4 and Mal2 associated |Schizosaccharomyces pombe|chr 3|||Manual Length = 233 Score = 25.4 bits (53), Expect = 5.3 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -2 Query: 470 TNIDQTRHRPHPLPVQTRHAPV 405 +N+D + PHP P Q PV Sbjct: 100 SNLDSVKSLPHPWPFQKESRPV 121 >SPCC11E10.03 |mug1||dynactin complex subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 351 Score = 25.4 bits (53), Expect = 5.3 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -3 Query: 358 FPYLHYSID*RLFTLETCCGYGYEPARHL 272 +P+ S+D R+F LE+ GY EP L Sbjct: 159 YPFDLDSLDKRIFKLESKIGYADEPLSEL 187 >SPBC106.01 |mph1|SPBC1271.16c, SPBC243.01|dual specificity protein kinase Mph1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 678 Score = 25.4 bits (53), Expect = 5.3 Identities = 16/54 (29%), Positives = 24/54 (44%) Frame = -3 Query: 259 SPNFQGPQRVSGHRRKCGALRVPNHISLL*DSMELERSGRKENSSRTSRRRLQA 98 +P + P VSGH LR+ IS SM +ERS R ++ + + Sbjct: 611 TPLAKKPLPVSGHTNNAHPLRLSTEISASQLSMIIERSVELSKHKRLNKELIDS 664 >SPAC3A12.05c |taf2||TATA-binding protein associated factor Taf2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1174 Score = 25.4 bits (53), Expect = 5.3 Identities = 16/60 (26%), Positives = 30/60 (50%) Frame = -2 Query: 389 YSEVTDPICRLPLPTLFYRLEALHLGDLLRIWVRTGATSPRTSLTEFSRSAESIRTPPQM 210 Y + + L +P+L RL A+HLG +I ++ +P +T ++ + TPP + Sbjct: 1093 YKAKSSLLVTLKIPSLIPRLRAIHLGK-GKIVIK---KAPLKQITSKTKEKSTSPTPPSI 1148 >SPCP31B10.07 |eft202||translation elongation factor 2 |Schizosaccharomyces pombe|chr 3|||Manual Length = 842 Score = 25.0 bits (52), Expect = 7.0 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +2 Query: 71 RVFDGVTQSGLKTPPRGPGRV 133 RVF G +SGLK +GP V Sbjct: 399 RVFSGTVRSGLKVRIQGPNYV 419 >SPCC777.02 |||transcription factor |Schizosaccharomyces pombe|chr 3|||Manual Length = 632 Score = 25.0 bits (52), Expect = 7.0 Identities = 13/53 (24%), Positives = 23/53 (43%) Frame = +1 Query: 7 PVPIPEPGSGTVSIIVPSSLKTSVRRGNPKWPEDAAERSGKSFLFCLSVRVPW 165 PV + G TV+ P+S+ + +P+ P A+ + CL + W Sbjct: 132 PVSLEVRGRNTVTFYGPTSIFGTSFTSSPRPPPSASIEDTYPIIHCLQLFFKW 184 >SPAC513.01c |eft201|eft2-1, etf2, SPAPYUK71.04c|translation elongation factor 2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 842 Score = 25.0 bits (52), Expect = 7.0 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +2 Query: 71 RVFDGVTQSGLKTPPRGPGRV 133 RVF G +SGLK +GP V Sbjct: 399 RVFSGTVRSGLKVRIQGPNYV 419 >SPBC16G5.15c |fkh2||fork head transcription factor Fkh2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 642 Score = 24.6 bits (51), Expect = 9.2 Identities = 13/40 (32%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = +1 Query: 7 PVPI-PEPGSGTVSIIVPSSLKTSVRRGNPKWPEDAAERS 123 P+PI P+ ++ P+S TS R P P+D S Sbjct: 338 PIPILPKMKDTSIPAAEPASSTTSARDQTPSTPKDVGSPS 377 >SPBC32H8.07 |git5|gpb1|heterotrimeric G protein beta subunit Git5|Schizosaccharomyces pombe|chr 2|||Manual Length = 305 Score = 24.6 bits (51), Expect = 9.2 Identities = 10/34 (29%), Positives = 17/34 (50%) Frame = -2 Query: 176 SIGFHGTRTLRQKRKLFPDLSAASSGHFGLPRRT 75 ++ GTR L+ K PD+ ++ G + L T Sbjct: 8 NVNIQGTRVLKNKLGKIPDIDISTDGKYLLSAST 41 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,320,063 Number of Sequences: 5004 Number of extensions: 49423 Number of successful extensions: 162 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 155 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 162 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 216376042 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -