BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0633 (554 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_01_0028 - 359988-359996,360228-360332,360415-360536,360676-36... 40 0.002 03_02_0234 + 6625417-6626184,6626314-6626339,6626435-6626531,662... 40 0.002 11_03_0201 + 11578163-11578915 35 0.038 12_02_0637 - 21437244-21438080 35 0.050 11_01_0792 + 6679002-6679603,6738490-6738520,6738532-6739644 35 0.050 10_05_0084 + 8956637-8956681,8957722-8957856,8958040-8958834 35 0.050 10_02_0198 - 6611775-6612611 35 0.050 08_02_0235 + 14627648-14628889 35 0.050 07_01_1086 - 9930311-9931993 35 0.050 04_01_0293 + 3881375-3883698,3906619-3907636,3907820-3908309,391... 35 0.050 09_02_0555 - 10588685-10592038 34 0.066 06_02_0319 + 14306464-14306577,14306623-14307117 34 0.066 03_02_1029 - 13488535-13493037 34 0.066 10_07_0032 + 12096290-12097042,12097056-12098066,12110194-12110454 34 0.088 07_03_1512 + 27288779-27289222,27298101-27298399,27298499-272985... 33 0.12 10_01_0300 - 3257584-3258825 33 0.15 01_04_0007 - 15038268-15039062,15039177-15039711,15039887-150399... 33 0.15 05_03_0031 - 7534327-7534480,7535546-7535649,7535724-7535793,753... 33 0.20 12_02_0214 + 15750620-15751273 32 0.27 11_04_0054 - 12895574-12895840,12906985-12908121,12908274-12908591 32 0.35 06_01_0584 - 4178391-4178732,4178854-4178915,4180361-4180481,418... 31 0.47 08_01_0749 + 7063297-7064370 31 0.62 06_03_0557 + 22133604-22134506 29 2.5 03_01_0227 - 1797353-1798519 29 2.5 01_01_0888 + 6990354-6991862,6991970-6992431 29 2.5 11_04_0272 - 15631598-15631898,15633162-15633291,15636394-156365... 29 3.3 10_05_0046 + 8516043-8516425,8517908-8518019,8518276-8518377,851... 29 3.3 07_03_1567 - 27772815-27773302,27773471-27773561,27773641-277739... 28 5.8 01_01_1022 - 8064032-8064657,8064823-8064893,8065926-8066047,806... 28 5.8 01_01_0566 - 4166511-4166632,4167302-4167375,4167509-4167648,416... 28 5.8 >10_01_0028 - 359988-359996,360228-360332,360415-360536,360676-360763, 360988-361056,361132-361461,361544-361610,361695-361753, 361838-362056,362224-362289,362370-362500,362683-362782, 362864-363001,363111-363218,363627-363723,363806-364257 Length = 719 Score = 39.5 bits (88), Expect = 0.002 Identities = 15/27 (55%), Positives = 21/27 (77%), Gaps = 1/27 (3%) Frame = +2 Query: 92 LEYYLKWKGYSDEDNTWEPEDNL-DCP 169 L + ++WKGY E++TWEP +NL DCP Sbjct: 434 LYFKVQWKGYGREEDTWEPIENLRDCP 460 >03_02_0234 + 6625417-6626184,6626314-6626339,6626435-6626531, 6627009-6627116,6627194-6627328,6627429-6627528, 6627763-6627974,6628060-6628125,6628231-6628464, 6628583-6628641,6628716-6628782,6628863-6629192, 6629267-6629335,6629417-6629503,6629605-6629692, 6630057-6630178,6630251-6630355,6630442-6630485, 6630558-6630627,6630711-6630814,6630980-6631189, 6632935-6633018,6633291-6634003,6634115-6634649, 6634703-6634789,6634826-6634970,6635049-6635125, 6635215-6635359,6635462-6635626,6635725-6635958 Length = 1761 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/35 (51%), Positives = 24/35 (68%), Gaps = 1/35 (2%) Frame = +2 Query: 80 KNGVLEYYLKWKGYSDEDNTWEPEDNL-DCPDLIQ 181 KNG L + ++WKGY +TWEP D L DCP+ I+ Sbjct: 576 KNG-LWFKVRWKGYDPSYDTWEPIDGLSDCPERIK 609 >11_03_0201 + 11578163-11578915 Length = 250 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/32 (43%), Positives = 22/32 (68%), Gaps = 1/32 (3%) Frame = +2 Query: 68 DRRIKNGVLEYY-LKWKGYSDEDNTWEPEDNL 160 +RR +N V +Y ++W +S+E+ TWE ED L Sbjct: 199 ERRTRNKVTRFYRVQWSHHSEEEATWEREDEL 230 >12_02_0637 - 21437244-21438080 Length = 278 Score = 34.7 bits (76), Expect = 0.050 Identities = 13/32 (40%), Positives = 23/32 (71%), Gaps = 1/32 (3%) Frame = +2 Query: 68 DRRIKNGVLEYY-LKWKGYSDEDNTWEPEDNL 160 +RR +N V+ + ++W +S+E++TWE ED L Sbjct: 227 ERRTRNRVIRFCKVQWSNHSEEESTWEREDEL 258 >11_01_0792 + 6679002-6679603,6738490-6738520,6738532-6739644 Length = 581 Score = 34.7 bits (76), Expect = 0.050 Identities = 13/32 (40%), Positives = 23/32 (71%), Gaps = 1/32 (3%) Frame = +2 Query: 68 DRRIKNGVLEYY-LKWKGYSDEDNTWEPEDNL 160 +RR +N V+ + ++W +S+E++TWE ED L Sbjct: 530 ERRTRNRVIRFCKVQWSNHSEEESTWEREDEL 561 >10_05_0084 + 8956637-8956681,8957722-8957856,8958040-8958834 Length = 324 Score = 34.7 bits (76), Expect = 0.050 Identities = 13/32 (40%), Positives = 23/32 (71%), Gaps = 1/32 (3%) Frame = +2 Query: 68 DRRIKNGVLEYY-LKWKGYSDEDNTWEPEDNL 160 +RR +N V+ + ++W +S+E++TWE ED L Sbjct: 273 ERRTRNRVIRFCKVQWSNHSEEESTWEREDEL 304 >10_02_0198 - 6611775-6612611 Length = 278 Score = 34.7 bits (76), Expect = 0.050 Identities = 13/32 (40%), Positives = 23/32 (71%), Gaps = 1/32 (3%) Frame = +2 Query: 68 DRRIKNGVLEYY-LKWKGYSDEDNTWEPEDNL 160 +RR +N V+ + ++W +S+E++TWE ED L Sbjct: 227 ERRTRNRVIHFCKVQWSNHSEEESTWEREDEL 258 >08_02_0235 + 14627648-14628889 Length = 413 Score = 34.7 bits (76), Expect = 0.050 Identities = 13/32 (40%), Positives = 23/32 (71%), Gaps = 1/32 (3%) Frame = +2 Query: 68 DRRIKNGVLEYY-LKWKGYSDEDNTWEPEDNL 160 +RR +N V+ + ++W +S+E++TWE ED L Sbjct: 362 ERRTRNRVIRFCKVQWSNHSEEESTWEREDEL 393 >07_01_1086 - 9930311-9931993 Length = 560 Score = 34.7 bits (76), Expect = 0.050 Identities = 13/32 (40%), Positives = 23/32 (71%), Gaps = 1/32 (3%) Frame = +2 Query: 68 DRRIKNGVLEYY-LKWKGYSDEDNTWEPEDNL 160 +RR +N V+ + ++W +S+E++TWE ED L Sbjct: 509 ERRTRNRVIRFCKVQWSNHSEEESTWEREDEL 540 >04_01_0293 + 3881375-3883698,3906619-3907636,3907820-3908309, 3914729-3914823,3914854-3915213 Length = 1428 Score = 34.7 bits (76), Expect = 0.050 Identities = 13/32 (40%), Positives = 23/32 (71%), Gaps = 1/32 (3%) Frame = +2 Query: 68 DRRIKNGVLEYY-LKWKGYSDEDNTWEPEDNL 160 +RR +N V+ + ++W +S+E++TWE ED L Sbjct: 1237 ERRTRNRVIRFCKVQWSNHSEEESTWEREDEL 1268 >09_02_0555 - 10588685-10592038 Length = 1117 Score = 34.3 bits (75), Expect = 0.066 Identities = 15/40 (37%), Positives = 26/40 (65%), Gaps = 3/40 (7%) Frame = +2 Query: 65 LDRRIKNGVLEYY-LKWKGYSDEDNTWEPEDNLDC--PDL 175 ++RR +N V+ + ++W +++E+ TWE ED L PDL Sbjct: 1065 MERRTRNRVIRFCKVQWSNHAEEEATWEREDELKAAHPDL 1104 >06_02_0319 + 14306464-14306577,14306623-14307117 Length = 202 Score = 34.3 bits (75), Expect = 0.066 Identities = 15/40 (37%), Positives = 26/40 (65%), Gaps = 3/40 (7%) Frame = +2 Query: 65 LDRRIKNGVLEYY-LKWKGYSDEDNTWEPEDNLDC--PDL 175 ++RR +N V+ + ++W +++E+ TWE ED L PDL Sbjct: 150 IERRTRNRVIRFCKVQWSNHAEEEATWEREDELKAAHPDL 189 >03_02_1029 - 13488535-13493037 Length = 1500 Score = 34.3 bits (75), Expect = 0.066 Identities = 15/40 (37%), Positives = 26/40 (65%), Gaps = 3/40 (7%) Frame = +2 Query: 65 LDRRIKNGVLEYY-LKWKGYSDEDNTWEPEDNLDC--PDL 175 ++RR +N V+ + ++W +++E+ TWE ED L PDL Sbjct: 1448 MERRTRNRVIRFCKVQWSNHAEEEATWEREDELKAAHPDL 1487 >10_07_0032 + 12096290-12097042,12097056-12098066,12110194-12110454 Length = 674 Score = 33.9 bits (74), Expect = 0.088 Identities = 15/40 (37%), Positives = 26/40 (65%), Gaps = 3/40 (7%) Frame = +2 Query: 65 LDRRIKNGVLEYY-LKWKGYSDEDNTWEPEDNLDC--PDL 175 ++RR +N V+ + ++W +++E+ TWE ED L PDL Sbjct: 622 MERRTRNRVIRFCKVQWSNHAEEEATWEREDELKTAHPDL 661 >07_03_1512 + 27288779-27289222,27298101-27298399,27298499-27298589, 27298701-27298766,27299151-27302660,27311604-27312224 Length = 1676 Score = 33.5 bits (73), Expect = 0.12 Identities = 13/34 (38%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Frame = +2 Query: 62 VLDRRIKNGVLEYY-LKWKGYSDEDNTWEPEDNL 160 V +R +N V+ + ++W +S+E++TWE ED L Sbjct: 1623 VSERNTRNRVIRFCKVQWSNHSEEESTWEREDEL 1656 >10_01_0300 - 3257584-3258825 Length = 413 Score = 33.1 bits (72), Expect = 0.15 Identities = 13/32 (40%), Positives = 23/32 (71%), Gaps = 1/32 (3%) Frame = +2 Query: 68 DRRIKNGVLEYY-LKWKGYSDEDNTWEPEDNL 160 +RR +N V+ + ++W +S+E++TWE ED L Sbjct: 362 ERRTRNRVICFCKVQWSNHSEEESTWEREDEL 393 >01_04_0007 - 15038268-15039062,15039177-15039711,15039887-15039936, 15040376-15040446,15040683-15040731 Length = 499 Score = 33.1 bits (72), Expect = 0.15 Identities = 14/32 (43%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +2 Query: 68 DRRIKNGVLEYY-LKWKGYSDEDNTWEPEDNL 160 +RR +N V + ++W +SDE+ TWE ED L Sbjct: 448 ERRTRNKVTSFCRVQWSHHSDEEATWEREDEL 479 >05_03_0031 - 7534327-7534480,7535546-7535649,7535724-7535793, 7535889-7535932,7536042-7536146,7536223-7536344, 7536807-7536894,7536966-7537052,7537718-7537786, 7537859-7538188,7539777-7539824,7540003-7540069, 7540150-7540208,7541220-7541453,7541536-7541601, 7541684-7541883,7542104-7542197,7542295-7542414, 7542596-7542703,7542808-7542871,7543378-7543409, 7546049-7548007 Length = 1407 Score = 32.7 bits (71), Expect = 0.20 Identities = 14/35 (40%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Frame = +2 Query: 80 KNGVLEYYLKWKGYSDEDNTWEPEDNL-DCPDLIQ 181 K+G L + ++WKGY +TWEP + L +C + I+ Sbjct: 953 KHG-LYFKVRWKGYGPHHDTWEPVEGLRNCKEAIR 986 >12_02_0214 + 15750620-15751273 Length = 217 Score = 32.3 bits (70), Expect = 0.27 Identities = 13/34 (38%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = +2 Query: 62 VLDRRIKNGVLEYY-LKWKGYSDEDNTWEPEDNL 160 V +R +N V+ + ++W +S+E+ TWE ED L Sbjct: 164 VSERNTRNRVIRFCKVQWSNHSEEEATWEREDEL 197 >11_04_0054 - 12895574-12895840,12906985-12908121,12908274-12908591 Length = 573 Score = 31.9 bits (69), Expect = 0.35 Identities = 13/31 (41%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +2 Query: 71 RRIKNGVLEYY-LKWKGYSDEDNTWEPEDNL 160 RR +N V+ + ++W +S+E+ TWE ED L Sbjct: 523 RRTRNKVIRFCKVQWSHHSEEEATWEREDEL 553 >06_01_0584 - 4178391-4178732,4178854-4178915,4180361-4180481, 4180592-4180732,4180830-4180959,4182306-4182436, 4182528-4182601,4182680-4182741,4183135-4183209, 4184658-4184760,4184835-4184991,4185549-4185743, 4186204-4186282,4186697-4186806,4187249-4187374, 4187475-4187541,4187622-4187791,4187880-4188018, 4188361-4188522,4188672-4188772,4188852-4188994, 4189438-4189537,4190364-4190414,4191062-4191169, 4191279-4191494,4191585-4191721,4191820-4191915, 4192017-4192234,4192764-4192925,4193006-4193163, 4194221-4194379 Length = 1364 Score = 31.5 bits (68), Expect = 0.47 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +2 Query: 71 RRIKNGVLEYYLKWKGYSDEDNTWEPEDNL 160 R+ G EYY+KWK + ++ TWE + ++ Sbjct: 160 RKSSTGEREYYVKWKELTYDECTWENDSDI 189 >08_01_0749 + 7063297-7064370 Length = 357 Score = 31.1 bits (67), Expect = 0.62 Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = +2 Query: 62 VLDRRIKNGVLEYY-LKWKGYSDEDNTWEPEDNL 160 V +R +N V + ++W +S+E+ TWE ED L Sbjct: 304 VSERNTRNRVTRFCKVQWSNHSEEEATWEREDEL 337 >06_03_0557 + 22133604-22134506 Length = 300 Score = 29.1 bits (62), Expect = 2.5 Identities = 10/32 (31%), Positives = 22/32 (68%), Gaps = 1/32 (3%) Frame = +2 Query: 68 DRRIKNGVLEYY-LKWKGYSDEDNTWEPEDNL 160 +R+ + +++Y ++W +S+++ TWE ED L Sbjct: 260 ERQTRRKTIKFYKVQWTNHSEDEATWEREDLL 291 >03_01_0227 - 1797353-1798519 Length = 388 Score = 29.1 bits (62), Expect = 2.5 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +2 Query: 86 GVLEYYLKWKGYSDEDNTWEPEDNLDCPDLIQ 181 G EY +KW E+ TWEP +N+D +L+Q Sbjct: 337 GKWEYLVKWVDI--EEATWEPAENVDA-ELLQ 365 Score = 27.9 bits (59), Expect = 5.8 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 6/64 (9%) Frame = +1 Query: 328 FDRGLE---PEKIIG---ATDSSGELMFLMKWQGTDEADLVPAKQANVRCPQVVIQFYEE 489 FD GLE E ++ A + G+ +L+KW +EA PA+ + ++Q +E+ Sbjct: 314 FDAGLEYAVAEAVVNKREAAEGEGKWEYLVKWVDIEEATWEPAENVDAE----LLQEFEQ 369 Query: 490 RLHG 501 R G Sbjct: 370 RQSG 373 >01_01_0888 + 6990354-6991862,6991970-6992431 Length = 656 Score = 29.1 bits (62), Expect = 2.5 Identities = 14/48 (29%), Positives = 24/48 (50%), Gaps = 3/48 (6%) Frame = -3 Query: 483 IKLNNYLWAPHISLFCWYKICFICSLPFHEE---HEFTTTIRSANYFF 349 +K+N LW ++L C + C + F+ E E+ +R N+FF Sbjct: 299 VKINLVLWCVSVALMCAVSALYACKVAFYFEAVRREYYHPVR-VNFFF 345 >11_04_0272 - 15631598-15631898,15633162-15633291,15636394-15636544, 15636632-15636730,15636912-15637063,15637079-15637301 Length = 351 Score = 28.7 bits (61), Expect = 3.3 Identities = 11/34 (32%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = +2 Query: 62 VLDRRIKNGVLEYY-LKWKGYSDEDNTWEPEDNL 160 V D + +N + + ++W Y+ ++ TWE ED+L Sbjct: 207 VTDLKTRNQTIRFLKVQWSHYTMDEATWEKEDDL 240 >10_05_0046 + 8516043-8516425,8517908-8518019,8518276-8518377, 8518605-8518657,8518976-8519062,8519162-8519830, 8520154-8520214,8520295-8520342 Length = 504 Score = 28.7 bits (61), Expect = 3.3 Identities = 11/23 (47%), Positives = 16/23 (69%), Gaps = 1/23 (4%) Frame = +2 Query: 113 KGYSDEDNTWEPEDNLD-CPDLI 178 +G+ + NTWEP +NL C D+I Sbjct: 218 RGWPESANTWEPLENLSACSDII 240 >07_03_1567 - 27772815-27773302,27773471-27773561,27773641-27773988, 27774929-27775110,27775191-27775368,27775453-27775605, 27775993-27776232,27776369-27776449,27776485-27776730, 27777151-27777240,27777536-27777778,27778365-27778529, 27779017-27779080,27779162-27779286,27779383-27779476, 27779647-27779714,27779798-27779989,27780618-27780752, 27780847-27780934,27781014-27781107,27781484-27781547, 27781657-27781708,27781911-27782014,27782099-27782158, 27782687-27782770,27782892-27783125,27783442-27783864, 27784675-27784736,27784867-27785521 Length = 1700 Score = 27.9 bits (59), Expect = 5.8 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = +2 Query: 89 VLEYYLKWKGYSDEDNTWEPEDNLD 163 V EY +KW+G ++TWE + +++ Sbjct: 524 VPEYLVKWQGLPYAESTWEKDTDIE 548 >01_01_1022 - 8064032-8064657,8064823-8064893,8065926-8066047, 8066540-8066689,8067153-8067179,8067485-8067552, 8067679-8067874 Length = 419 Score = 27.9 bits (59), Expect = 5.8 Identities = 14/32 (43%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = +1 Query: 373 SSGELMFLMKWQGTD-EADLVPAKQANVRCPQ 465 SSG + MKW GTD + PAK N P+ Sbjct: 296 SSGLSLQTMKWWGTDSHTETTPAKDDNGEAPE 327 >01_01_0566 - 4166511-4166632,4167302-4167375,4167509-4167648, 4167731-4167802,4167915-4167984,4168112-4168185, 4168316-4168487,4168887-4168976,4169151-4169175, 4169273-4169432,4169855-4170265,4170443-4170559 Length = 508 Score = 27.9 bits (59), Expect = 5.8 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -3 Query: 423 CFICSLPFHEEHEFTTTIRSANYFFWF*STIKTR 322 CF+ SL F+ + ++ +F F ST++TR Sbjct: 157 CFVSSLQFNSDFSLRFSLHFLFFFVMFLSTVRTR 190 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,334,558 Number of Sequences: 37544 Number of extensions: 183257 Number of successful extensions: 503 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 490 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 503 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1257681096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -