BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0619 (669 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC114377-1|AAI14378.1| 44|Homo sapiens Unknown (protein for MG... 62 1e-09 AB127405-1|BAD03968.1| 1183|Homo sapiens SNAP-25-interacting pro... 31 3.7 BC048251-1|AAH48251.1| 322|Homo sapiens ZDHHC12 protein protein. 30 6.5 AL441992-6|CAI15406.1| 210|Homo sapiens zinc finger, DHHC-type ... 30 6.5 >BC114377-1|AAI14378.1| 44|Homo sapiens Unknown (protein for MGC:134704) protein. Length = 44 Score = 62.5 bits (145), Expect = 1e-09 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +1 Query: 424 MIGRADIEGSKSNVAMNAWLPQASYPCGTF 513 MIGRADIEGSKS+VAMNAW PQASYPCG F Sbjct: 1 MIGRADIEGSKSDVAMNAWPPQASYPCGNF 30 >AB127405-1|BAD03968.1| 1183|Homo sapiens SNAP-25-interacting protein protein. Length = 1183 Score = 31.1 bits (67), Expect = 3.7 Identities = 30/94 (31%), Positives = 44/94 (46%), Gaps = 2/94 (2%) Frame = -2 Query: 335 YPTDGLSLR**YCSVREEPQFRTFGSCLGRAAGGAKLPSAGLCLNASKAEASLAESGKDM 156 YP L+LR +RE+P + +F + R GA+ GL A+K + AES + M Sbjct: 91 YPQHALALRGQQDRMREQPNYWSFKTRSSRHTQGAQ---PGLADQAAKLSYASAESLETM 147 Query: 155 LTVEPRESGGSKQCDFTSR--VSHSKRETRRRSP 60 E G S+ F +S S +T+ RSP Sbjct: 148 SEAE-LPLGFSRMNRFRQSLPLSRSASQTKPRSP 180 >BC048251-1|AAH48251.1| 322|Homo sapiens ZDHHC12 protein protein. Length = 322 Score = 30.3 bits (65), Expect = 6.5 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = -3 Query: 202 TPLRPKPA*PNPARICSLWSPESRE 128 TP P P P PA +CS SPE R+ Sbjct: 68 TPTPPTPVLPGPASLCSPASPELRQ 92 >AL441992-6|CAI15406.1| 210|Homo sapiens zinc finger, DHHC-type containing 12 protein. Length = 210 Score = 30.3 bits (65), Expect = 6.5 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = -3 Query: 202 TPLRPKPA*PNPARICSLWSPESRE 128 TP P P P PA +CS SPE R+ Sbjct: 68 TPTPPTPVLPGPASLCSPASPELRQ 92 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,004,007 Number of Sequences: 237096 Number of extensions: 2307866 Number of successful extensions: 5137 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4819 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5133 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7591280850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -