BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0611 (639 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 23 2.5 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 23 2.5 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 22 4.4 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 22 4.4 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 22 4.4 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 22 4.4 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 22 4.4 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 23.0 bits (47), Expect = 2.5 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = -2 Query: 533 CSVRIGTAKHGLSIL*YKEFLARGARKVTTGITGL 429 CS IG H L KEF R +++ GI + Sbjct: 168 CSTPIGNLSHALLKDPVKEFWERRTLQISDGIENI 202 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 23.0 bits (47), Expect = 2.5 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = -2 Query: 533 CSVRIGTAKHGLSIL*YKEFLARGARKVTTGITGL 429 CS IG H L KEF R +++ GI + Sbjct: 221 CSTPIGNLSHALLKDPVKEFWERRTLQISDGIENI 255 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 22.2 bits (45), Expect = 4.4 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -1 Query: 198 ALGRAAGGAKLPSAGLCLNASKAEASL 118 ALGR AGG S+ L L+ + +SL Sbjct: 5 ALGRCAGGGGRLSSVLSLSLTSLASSL 31 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 22.2 bits (45), Expect = 4.4 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -1 Query: 198 ALGRAAGGAKLPSAGLCLNASKAEASL 118 ALGR AGG S+ L L+ + +SL Sbjct: 5 ALGRCAGGGGRLSSVLSLSLTSLASSL 31 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 22.2 bits (45), Expect = 4.4 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -1 Query: 198 ALGRAAGGAKLPSAGLCLNASKAEASL 118 ALGR AGG S+ L L+ + +SL Sbjct: 5 ALGRCAGGGGRLSSVLSLSLTSLASSL 31 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 22.2 bits (45), Expect = 4.4 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -1 Query: 198 ALGRAAGGAKLPSAGLCLNASKAEASL 118 ALGR AGG S+ L L+ + +SL Sbjct: 5 ALGRCAGGGGRLSSVLSLSLTSLASSL 31 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 22.2 bits (45), Expect = 4.4 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = +1 Query: 172 RTTGRSAECMNQMSETAVPLVLSS 243 + G+ +C N MSE V ++L + Sbjct: 170 KENGKEFDCHNYMSELTVDILLET 193 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,984 Number of Sequences: 438 Number of extensions: 3895 Number of successful extensions: 10 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19193721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -