BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0611 (639 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g54020.2 68414.m06155 myrosinase-associated protein, putative... 31 0.65 At5g23630.1 68418.m02771 ATPase E1-E2 type family protein / halo... 29 2.0 At4g03000.2 68417.m00408 expressed protein contains similarity t... 28 4.5 At4g03000.1 68417.m00407 expressed protein contains similarity t... 28 4.5 >At1g54020.2 68414.m06155 myrosinase-associated protein, putative strong similarity to myrosinase-associated proteins GI:1769968, GI:1769970, GI:1216389,GI:1216391 from [Brassica napus]; contains InterPro Entry IPR001087 Lipolytic enzyme, G-D-S-L family Length = 372 Score = 31.1 bits (67), Expect = 0.65 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = -3 Query: 436 LACGSQAFIATLLFDPSMSALPIIAKQNSPSVGLFT 329 + C S + + LL P + L I+ QN P+VGLFT Sbjct: 1 MECSSVSVLGILLVFPLLHNLVTISGQNLPAVGLFT 36 >At5g23630.1 68418.m02771 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase familiy protein similar to SP|O14072 Cation-transporting ATPase 4 (EC 3.6.3.-) {Schizosaccharomyces pombe}; contains InterPro accession IPR001757: ATPase, E1-E2 type; contains Pfam profile PF00702: haloacid dehalogenase-like hydrolase Length = 1179 Score = 29.5 bits (63), Expect = 2.0 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = +1 Query: 493 IDRPCFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTD 627 +D CF + +DQA C P + S E+ H R +TD Sbjct: 73 VDFKCFVQFSKVNSIDQADACKVTPAKFSGSKEVVPLHFRSQMTD 117 >At4g03000.2 68417.m00408 expressed protein contains similarity to hypothetical proteins Length = 814 Score = 28.3 bits (60), Expect = 4.5 Identities = 17/46 (36%), Positives = 23/46 (50%) Frame = -1 Query: 144 NASKAEASLAEPGKDMLTVEPRESGGPKQCDLTSRVSHSKRETRRR 7 N+ AS A PGK++ +V G K LTS VS K + R+ Sbjct: 272 NSKNPHASGATPGKEVFSVSTASGEGTKSASLTS-VSDEKLVSCRK 316 >At4g03000.1 68417.m00407 expressed protein contains similarity to hypothetical proteins Length = 814 Score = 28.3 bits (60), Expect = 4.5 Identities = 17/46 (36%), Positives = 23/46 (50%) Frame = -1 Query: 144 NASKAEASLAEPGKDMLTVEPRESGGPKQCDLTSRVSHSKRETRRR 7 N+ AS A PGK++ +V G K LTS VS K + R+ Sbjct: 272 NSKNPHASGATPGKEVFSVSTASGEGTKSASLTS-VSDEKLVSCRK 316 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,906,108 Number of Sequences: 28952 Number of extensions: 284349 Number of successful extensions: 653 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 644 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 653 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1314848736 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -