BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0610 (580 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF487535-1|AAL93296.1| 494|Anopheles gambiae cytochrome P450 CY... 25 2.3 AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 24 4.1 AY659930-1|AAT51798.2| 144|Anopheles gambiae lysozyme c-3 protein. 23 7.2 AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 pr... 23 7.2 AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CY... 23 7.2 >AF487535-1|AAL93296.1| 494|Anopheles gambiae cytochrome P450 CYP6Z1 protein. Length = 494 Score = 24.6 bits (51), Expect = 2.3 Identities = 9/33 (27%), Positives = 18/33 (54%) Frame = -3 Query: 308 FRCPGLVRFPVLSQIKPQLHSWWCPSVNSFKFQ 210 F CPGL++F ++ + P + + ++S Q Sbjct: 222 FLCPGLLKFTGINSLSPPMKKFTTEVISSHLHQ 254 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 23.8 bits (49), Expect = 4.1 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = -1 Query: 361 GHAPPPTESRKSC*SVNPSGVRAW*DFPC*V-KLSRSSTPGGALPSIP 221 G APPP R+ +P VRA + + +L R G LP++P Sbjct: 1113 GEAPPPIPMRRRGLPPSPRTVRARHERRLYLQRLYRQRAREGTLPTVP 1160 >AY659930-1|AAT51798.2| 144|Anopheles gambiae lysozyme c-3 protein. Length = 144 Score = 23.0 bits (47), Expect = 7.2 Identities = 8/22 (36%), Positives = 15/22 (68%) Frame = +3 Query: 381 ICLVNSGNERDSSLLNRRRYLG 446 ICL+ + + D+S LN++ + G Sbjct: 44 ICLIQNESRYDTSALNKKNWNG 65 >AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 protein. Length = 492 Score = 23.0 bits (47), Expect = 7.2 Identities = 8/22 (36%), Positives = 15/22 (68%) Frame = -3 Query: 308 FRCPGLVRFPVLSQIKPQLHSW 243 F CPGL++ ++ + P+L S+ Sbjct: 222 FICPGLLKLTRITSLPPELISF 243 >AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CYP6Z2 protein protein. Length = 490 Score = 23.0 bits (47), Expect = 7.2 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = -3 Query: 308 FRCPGLVRFPVLSQIKPQL 252 F CPGL++ ++ ++P+L Sbjct: 222 FICPGLLKLTRMTSLQPEL 240 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 618,530 Number of Sequences: 2352 Number of extensions: 13418 Number of successful extensions: 24 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 55086417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -