BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0610 (580 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE013599-3301|AAF46781.2| 408|Drosophila melanogaster CG13495-P... 32 0.49 AE014298-2120|AAF48437.1| 984|Drosophila melanogaster CG5877-PA... 31 1.5 AE013599-1608|ABC66062.1| 1526|Drosophila melanogaster CG3845-PC... 31 1.5 AB096103-1|BAD83642.1| 1526|Drosophila melanogaster hypothetical... 31 1.5 >AE013599-3301|AAF46781.2| 408|Drosophila melanogaster CG13495-PA protein. Length = 408 Score = 32.3 bits (70), Expect = 0.49 Identities = 14/45 (31%), Positives = 26/45 (57%) Frame = -3 Query: 338 IKKELLICQSFRCPGLVRFPVLSQIKPQLHSWWCPSVNSFKFQLC 204 I+K +L+ +F C ++++ +LS I PQ+ +C + F LC Sbjct: 147 IRKIILLYSAFLCSTVLQYQLLSVINPQIFLAFCARLTHFLHFLC 191 >AE014298-2120|AAF48437.1| 984|Drosophila melanogaster CG5877-PA, isoform A protein. Length = 984 Score = 30.7 bits (66), Expect = 1.5 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -2 Query: 387 DKSLHQLRTAMHHHPPNQE 331 ++ +H L TAM HHP NQ+ Sbjct: 211 EQQIHSLETAMEHHPSNQQ 229 >AE013599-1608|ABC66062.1| 1526|Drosophila melanogaster CG3845-PC, isoform C protein. Length = 1526 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/47 (31%), Positives = 20/47 (42%) Frame = -3 Query: 197 TPPGVQNLWFPGSCPPSHCSNVGGSLDDIFTVRTRAVSNRLRTSNFR 57 TPP + W P S P H D +F R R + N+L F+ Sbjct: 527 TPPPITGRWIPPSLRPQHGLTQSEKNDAVFR-RVRGILNKLTPEKFQ 572 >AB096103-1|BAD83642.1| 1526|Drosophila melanogaster hypothetical protein protein. Length = 1526 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/47 (31%), Positives = 20/47 (42%) Frame = -3 Query: 197 TPPGVQNLWFPGSCPPSHCSNVGGSLDDIFTVRTRAVSNRLRTSNFR 57 TPP + W P S P H D +F R R + N+L F+ Sbjct: 527 TPPPITGRWIPPSLRPQHGLTQSEKNDAVFR-RVRGILNKLTPEKFQ 572 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,059,333 Number of Sequences: 53049 Number of extensions: 635399 Number of successful extensions: 1772 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1685 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1771 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2296745289 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -