BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0599 (400 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1281 - 25439634-25439750,25439868-25440071,25440328-254404... 27 4.1 >07_03_1281 - 25439634-25439750,25439868-25440071,25440328-25440402, 25440477-25440631,25440704-25440824,25440946-25441020, 25441216-25441353,25441617-25441727,25441883-25441987, 25442061-25442139,25442488-25442549,25442634-25442699, 25442812-25442907,25443353-25443403,25443629-25443709 Length = 511 Score = 27.5 bits (58), Expect = 4.1 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +2 Query: 245 KPKLKVRGPAVTHALSSVVMIKGTLHFVLRNI 340 K + VRG VTHA + + LHF+L+N+ Sbjct: 30 KCEYAVRGEIVTHAQDFLRNLDYDLHFILQNL 61 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,856,149 Number of Sequences: 37544 Number of extensions: 135765 Number of successful extensions: 218 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 216 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 218 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 682720236 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -