BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0584 (633 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein p... 28 0.066 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 26 0.35 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 26 0.35 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 26 0.35 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 26 0.35 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 26 0.35 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 26 0.35 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 24 1.1 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 23 2.5 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 23 2.5 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 23 2.5 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 23 2.5 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 23 3.3 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 23 3.3 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 21 7.5 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 21 7.5 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 21 7.5 DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 21 7.5 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 21 7.5 AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 21 7.5 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 21 9.9 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 9.9 >DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein protein. Length = 430 Score = 28.3 bits (60), Expect = 0.066 Identities = 13/27 (48%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = -3 Query: 280 ILIPKLRIHLPTSLTYIILST-RGSSP 203 + +P+ R +P +LTYI L T RG SP Sbjct: 81 VTVPRWRNGIPATLTYISLDTNRGGSP 107 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 25.8 bits (54), Expect = 0.35 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 553 RTESCRSRTKRNRHDLRLGRSAEGRRTRVRIQS 455 RT SC SR + +RH+ R +G R+ R +S Sbjct: 226 RTSSCHSRYEDSRHEDRNSYRNDGERSCSRDRS 258 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 25.8 bits (54), Expect = 0.35 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 553 RTESCRSRTKRNRHDLRLGRSAEGRRTRVRIQS 455 RT SC SR + +RH+ R +G R+ R +S Sbjct: 226 RTSSCHSRYEDSRHEDRNSYRNDGERSCSRDRS 258 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 25.8 bits (54), Expect = 0.35 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 553 RTESCRSRTKRNRHDLRLGRSAEGRRTRVRIQS 455 RT SC SR + +RH+ R +G R+ R +S Sbjct: 226 RTSSCHSRYEDSRHEDRNSYRNDGERSCSRDRS 258 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 25.8 bits (54), Expect = 0.35 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 553 RTESCRSRTKRNRHDLRLGRSAEGRRTRVRIQS 455 RT SC SR + +RH+ R +G R+ R +S Sbjct: 226 RTSSCHSRYEDSRHEDRNSYRNDGERSCSRDRS 258 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 25.8 bits (54), Expect = 0.35 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 553 RTESCRSRTKRNRHDLRLGRSAEGRRTRVRIQS 455 RT SC SR + +RH+ R +G R+ R +S Sbjct: 226 RTSSCHSRYEDSRHEDRNSYRNDGERSCSRDRS 258 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 25.8 bits (54), Expect = 0.35 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 553 RTESCRSRTKRNRHDLRLGRSAEGRRTRVRIQS 455 RT SC SR + +RH+ R +G R+ R +S Sbjct: 226 RTSSCHSRYEDSRHEDRNSYRNDGERSCSRDRS 258 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 24.2 bits (50), Expect = 1.1 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -3 Query: 553 RTESCRSRTKRNRHDLRLGRSAEGRRTRVRIQS 455 RT SC SR + RH+ R +G R+ R +S Sbjct: 226 RTSSCHSRYEDLRHEDRNSYRNDGERSCSRDRS 258 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.0 bits (47), Expect = 2.5 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -3 Query: 553 RTESCRSRTKRNRHDLRLGRSAEGRRTRVRIQS 455 RT SC SR + +RH+ +G R+ R +S Sbjct: 226 RTSSCHSRYEDSRHEDGNSYRNDGERSCSRDRS 258 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 23.0 bits (47), Expect = 2.5 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = -2 Query: 542 VPIAHETKPTRLTARKIRGRPENAGPDPVRNVRR 441 VPI TKP AR +G N G + V V++ Sbjct: 292 VPIDANTKPCTWAARPWQGYMTNNGVNNVEAVQK 325 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 23.0 bits (47), Expect = 2.5 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = -2 Query: 542 VPIAHETKPTRLTARKIRGRPENAGPDPVRNVRR 441 VPI TKP AR +G N G + V V++ Sbjct: 292 VPIDANTKPCTWAARPWQGYMTNNGVNNVEAVQK 325 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 23.0 bits (47), Expect = 2.5 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = -2 Query: 542 VPIAHETKPTRLTARKIRGRPENAGPDPVRNVRR 441 VPI TKP AR +G N G + V V++ Sbjct: 292 VPIDANTKPCTWAARPWQGYMTNNGVNNVEAVQK 325 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 22.6 bits (46), Expect = 3.3 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +3 Query: 318 KRMRPVPGLVDVRALCSF*RVSILI*CGLKNCI 416 K +RPV DV +C ++S LI LKN I Sbjct: 42 KLVRPVVNTSDVLRVCIKLKLSQLIDVNLKNQI 74 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 22.6 bits (46), Expect = 3.3 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +3 Query: 318 KRMRPVPGLVDVRALCSF*RVSILI*CGLKNCI 416 K +RPV DV +C ++S LI LKN I Sbjct: 42 KLVRPVVNTSDVLRVCIKLKLSQLIDVNLKNQI 74 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 7.5 Identities = 17/63 (26%), Positives = 27/63 (42%) Frame = -2 Query: 500 RKIRGRPENAGPDPVRNVRRFSRVSY*IYTVFEAALY*NTNSLKRT*RTNIDQTRHRPHP 321 RK R + D R R S+ I ++ ++ N N+ K+ NI+ P P Sbjct: 57 RKYRETSKERSRD--RKERERSKEPKIISSLSNKTIHNNNNNYKKLQYYNINYIEQIPVP 114 Query: 320 LPV 312 +PV Sbjct: 115 VPV 117 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 7.5 Identities = 17/63 (26%), Positives = 27/63 (42%) Frame = -2 Query: 500 RKIRGRPENAGPDPVRNVRRFSRVSY*IYTVFEAALY*NTNSLKRT*RTNIDQTRHRPHP 321 RK R + D R R S+ I ++ ++ N N+ K+ NI+ P P Sbjct: 57 RKYRETSKERSRD--RKERERSKEPKIISSLSNKTIHNNNNNYKKLQYYNINYIEQIPVP 114 Query: 320 LPV 312 +PV Sbjct: 115 VPV 117 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 7.5 Identities = 17/63 (26%), Positives = 27/63 (42%) Frame = -2 Query: 500 RKIRGRPENAGPDPVRNVRRFSRVSY*IYTVFEAALY*NTNSLKRT*RTNIDQTRHRPHP 321 RK R + D R R S+ I ++ ++ N N+ K+ NI+ P P Sbjct: 57 RKYRETSKERSRD--RKERERSKEPKIISSLSNKTIHNNNNNYKKLQYYNINYIEQIPVP 114 Query: 320 LPV 312 +PV Sbjct: 115 VPV 117 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 21.4 bits (43), Expect = 7.5 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = -2 Query: 80 SEPYLPSIGFHGTRTLRQKRKLFPD 6 SE P+ HG R RQ+ + D Sbjct: 472 SENNYPTTSIHGDRLQRQREEALAD 496 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 21.4 bits (43), Expect = 7.5 Identities = 17/63 (26%), Positives = 27/63 (42%) Frame = -2 Query: 500 RKIRGRPENAGPDPVRNVRRFSRVSY*IYTVFEAALY*NTNSLKRT*RTNIDQTRHRPHP 321 RK R + D R R S+ I ++ ++ N N+ K+ NI+ P P Sbjct: 290 RKYRETSKERSRD--RKERERSKEPKIISSLSNKTIHNNNNNYKKLQYYNINYIEQIPVP 347 Query: 320 LPV 312 +PV Sbjct: 348 VPV 350 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 21.4 bits (43), Expect = 7.5 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = -2 Query: 566 VERRSYRIVPIAHETKPTRLTARKIRGRPEN 474 VE + Y+ V I+ T+P+ T + P N Sbjct: 183 VEEQRYKQVEISQMTEPSSSTKSYVLEGPRN 213 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 21.0 bits (42), Expect = 9.9 Identities = 16/63 (25%), Positives = 27/63 (42%) Frame = -2 Query: 500 RKIRGRPENAGPDPVRNVRRFSRVSY*IYTVFEAALY*NTNSLKRT*RTNIDQTRHRPHP 321 RK R + D R R S+ I ++ ++ N N+ K+ NI+ P P Sbjct: 57 RKYRETSKERSRD--RKERERSKEPKIISSLSNKTIHNNNNNYKKLQYYNINYIEQIPVP 114 Query: 320 LPV 312 +P+ Sbjct: 115 VPI 117 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.0 bits (42), Expect = 9.9 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = -2 Query: 329 PHPLPVQTRHAPVLRANPYSEV 264 P PLP A + + +PYS + Sbjct: 652 PFPLPPNLASANISQLDPYSSL 673 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 188,621 Number of Sequences: 438 Number of extensions: 4486 Number of successful extensions: 24 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18949215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -