BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0555 (454 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X04701-1|CAA28407.1| 705|Homo sapiens protein ( Human mRNA for ... 31 1.8 M14058-1|AAA51851.1| 705|Homo sapiens C1R protein. 31 1.8 BC035220-1|AAH35220.1| 705|Homo sapiens complement component 1,... 31 1.8 AB083037-1|BAC19850.2| 705|Homo sapiens r subcomponent of compl... 31 1.8 BC110451-1|AAI10452.1| 1042|Homo sapiens corin, serine peptidase... 29 7.4 AF133845-1|AAD31850.1| 1042|Homo sapiens corin protein. 29 7.4 BC126405-1|AAI26406.1| 1613|Homo sapiens low density lipoprotein... 29 9.8 BC117136-1|AAI17137.1| 1613|Homo sapiens low density lipoprotein... 29 9.8 AF074264-1|AAC33006.1| 1613|Homo sapiens LDL receptor-related pr... 29 9.8 AB209683-1|BAD92920.1| 1477|Homo sapiens low density lipoprotein... 29 9.8 >X04701-1|CAA28407.1| 705|Homo sapiens protein ( Human mRNA for complement component C1r. ). Length = 705 Score = 31.1 bits (67), Expect = 1.8 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +2 Query: 257 D*RDSHCPYLLSSETTAKGTGLGESAGKEDPVELDSS 367 D + HCPY + A G +GE GK+ P +LD+S Sbjct: 244 DHQQVHCPYD-QLQIYANGKNIGEFCGKQRPPDLDTS 279 >M14058-1|AAA51851.1| 705|Homo sapiens C1R protein. Length = 705 Score = 31.1 bits (67), Expect = 1.8 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +2 Query: 257 D*RDSHCPYLLSSETTAKGTGLGESAGKEDPVELDSS 367 D + HCPY + A G +GE GK+ P +LD+S Sbjct: 244 DHQQVHCPYD-QLQIYANGKNIGEFCGKQRPPDLDTS 279 >BC035220-1|AAH35220.1| 705|Homo sapiens complement component 1, r subcomponent protein. Length = 705 Score = 31.1 bits (67), Expect = 1.8 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +2 Query: 257 D*RDSHCPYLLSSETTAKGTGLGESAGKEDPVELDSS 367 D + HCPY + A G +GE GK+ P +LD+S Sbjct: 244 DHQQVHCPYD-QLQIYANGKNIGEFCGKQRPPDLDTS 279 >AB083037-1|BAC19850.2| 705|Homo sapiens r subcomponent of complement component 1 protein. Length = 705 Score = 31.1 bits (67), Expect = 1.8 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +2 Query: 257 D*RDSHCPYLLSSETTAKGTGLGESAGKEDPVELDSS 367 D + HCPY + A G +GE GK+ P +LD+S Sbjct: 244 DHQQVHCPYD-QLQIYANGKNIGEFCGKQRPPDLDTS 279 >BC110451-1|AAI10452.1| 1042|Homo sapiens corin, serine peptidase protein. Length = 1042 Score = 29.1 bits (62), Expect = 7.4 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = +1 Query: 52 WHGQGESDCLIKTKHCDGPRGC*RNVISAQCSECQREEIQAS 177 W CL T CDG C + CS CQ +E++ + Sbjct: 622 WECPSNKQCLKHTVICDGFPDCPDYMDEKNCSFCQDDELECA 663 >AF133845-1|AAD31850.1| 1042|Homo sapiens corin protein. Length = 1042 Score = 29.1 bits (62), Expect = 7.4 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = +1 Query: 52 WHGQGESDCLIKTKHCDGPRGC*RNVISAQCSECQREEIQAS 177 W CL T CDG C + CS CQ +E++ + Sbjct: 622 WECPSNKQCLKHTVICDGFPDCPDYMDEKNCSFCQDDELECA 663 >BC126405-1|AAI26406.1| 1613|Homo sapiens low density lipoprotein receptor-related protein 6 protein. Length = 1613 Score = 28.7 bits (61), Expect = 9.8 Identities = 12/41 (29%), Positives = 18/41 (43%) Frame = +1 Query: 64 GESDCLIKTKHCDGPRGC*RNVISAQCSECQREEIQASAGK 186 GE DC+ CDG C + C C + Q ++G+ Sbjct: 1259 GEIDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQ 1299 >BC117136-1|AAI17137.1| 1613|Homo sapiens low density lipoprotein receptor-related protein 6 protein. Length = 1613 Score = 28.7 bits (61), Expect = 9.8 Identities = 12/41 (29%), Positives = 18/41 (43%) Frame = +1 Query: 64 GESDCLIKTKHCDGPRGC*RNVISAQCSECQREEIQASAGK 186 GE DC+ CDG C + C C + Q ++G+ Sbjct: 1259 GEIDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQ 1299 >AF074264-1|AAC33006.1| 1613|Homo sapiens LDL receptor-related protein 6 protein. Length = 1613 Score = 28.7 bits (61), Expect = 9.8 Identities = 12/41 (29%), Positives = 18/41 (43%) Frame = +1 Query: 64 GESDCLIKTKHCDGPRGC*RNVISAQCSECQREEIQASAGK 186 GE DC+ CDG C + C C + Q ++G+ Sbjct: 1259 GEIDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQ 1299 >AB209683-1|BAD92920.1| 1477|Homo sapiens low density lipoprotein receptor-related protein 6 variant protein. Length = 1477 Score = 28.7 bits (61), Expect = 9.8 Identities = 12/41 (29%), Positives = 18/41 (43%) Frame = +1 Query: 64 GESDCLIKTKHCDGPRGC*RNVISAQCSECQREEIQASAGK 186 GE DC+ CDG C + C C + Q ++G+ Sbjct: 1123 GEIDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQ 1163 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 64,343,482 Number of Sequences: 237096 Number of extensions: 1286131 Number of successful extensions: 2818 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 2632 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2817 length of database: 76,859,062 effective HSP length: 84 effective length of database: 56,942,998 effective search space used: 3758237868 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -