BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0555 (454 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. 22 3.6 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 4.7 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 21 6.3 AF393497-1|AAL60422.1| 143|Apis mellifera odorant binding prote... 21 6.3 >AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. Length = 316 Score = 21.8 bits (44), Expect = 3.6 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = -2 Query: 432 SDDRAKRSPTYATPLMSPYNARLESSSTGSSFPADSP 322 +D R SP TP+ + Y +E+ + S F D+P Sbjct: 21 NDKRIYLSPR--TPIKNVYKNNIETKNQLSPFNIDTP 55 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.4 bits (43), Expect = 4.7 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -2 Query: 399 ATPLMSPYNARLESSSTGSSFP 334 A + SP + SSTGSS P Sbjct: 347 AKQMASPEPPKSSESSTGSSIP 368 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.0 bits (42), Expect = 6.3 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +3 Query: 330 QRGKKTLLSLTLVWHCKE 383 + G KTLLS T +W ++ Sbjct: 231 KNGMKTLLSETDIWEVEQ 248 >AF393497-1|AAL60422.1| 143|Apis mellifera odorant binding protein ASP5 protein. Length = 143 Score = 21.0 bits (42), Expect = 6.3 Identities = 10/38 (26%), Positives = 17/38 (44%) Frame = -1 Query: 448 KVVVFQRRSRETISHLCYTSHVSLQCQTRVKLNRVFFP 335 K +V R+ E C ++ +QC + + FFP Sbjct: 106 KEIVAVCRNEEYTGDDCQKTYQYVQCHYKQNPEKFFFP 143 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,979 Number of Sequences: 438 Number of extensions: 2671 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11943513 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -