BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0482 (340 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974166-1|ABJ52806.1| 494|Anopheles gambiae serpin 6 protein. 26 0.45 AJ130950-1|CAA10259.1| 114|Anopheles gambiae SG2 protein protein. 23 2.4 AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ chann... 23 3.1 AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium ch... 23 3.1 DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 23 4.2 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 23 4.2 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 23 4.2 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 23 4.2 Z22930-7|CAA80512.1| 274|Anopheles gambiae trypsin protein. 22 7.3 Z18889-1|CAA79327.1| 274|Anopheles gambiae trypsin protein. 22 7.3 U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 22 7.3 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 22 7.3 AF543192-1|AAN40409.1| 636|Anopheles gambiae amino acid transpo... 22 7.3 X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 21 9.6 DQ974163-1|ABJ52803.1| 595|Anopheles gambiae serpin 4B protein. 21 9.6 >DQ974166-1|ABJ52806.1| 494|Anopheles gambiae serpin 6 protein. Length = 494 Score = 25.8 bits (54), Expect = 0.45 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 138 NSSRTSRRRLQATL 97 NSSRT+ RRLQATL Sbjct: 350 NSSRTAIRRLQATL 363 >AJ130950-1|CAA10259.1| 114|Anopheles gambiae SG2 protein protein. Length = 114 Score = 23.4 bits (48), Expect = 2.4 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = -1 Query: 121 SAASSGHFGLPRRTLVFKDEGTIIETVPLPGSGIGTGFPF 2 S+ + F +P T F D T I +P G+G G GFPF Sbjct: 76 SSGAFPQFSIPSWTN-FTDAFTSI--LPFFGNGQGGGFPF 112 >AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ channel protein. Length = 574 Score = 23.0 bits (47), Expect = 3.1 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = -3 Query: 200 FRTISPFYRIPWNSNAQAEKKTLPGPLGGVFRPLWVTPSN 81 F T+ Y N+ A + T G G FRP+ TP N Sbjct: 213 FNTLDTVYMFR-NATAPSIFPTEVGSSSGRFRPILWTPEN 251 >AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium channel protein. Length = 572 Score = 23.0 bits (47), Expect = 3.1 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = -3 Query: 200 FRTISPFYRIPWNSNAQAEKKTLPGPLGGVFRPLWVTPSN 81 F T+ Y N+ A + T G G FRP+ TP N Sbjct: 213 FNTLDTVYMFR-NATAPSIFPTEVGSSSGRFRPILWTPEN 251 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 22.6 bits (46), Expect = 4.2 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -3 Query: 176 RIPWNSNAQAEKKTLPGPLG 117 +IPW+ NA+A K G G Sbjct: 317 QIPWDRNAEALAKWASGQTG 336 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 22.6 bits (46), Expect = 4.2 Identities = 9/25 (36%), Positives = 11/25 (44%) Frame = -2 Query: 282 HLHVHPSPEFQGPQRVSGHRRECGA 208 H H + GP +S R CGA Sbjct: 660 HAQHHSNGTHHGPSLMSSARESCGA 684 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 22.6 bits (46), Expect = 4.2 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = -1 Query: 100 FGLPRRTLVFKDEGTI 53 FG+P++ + KD GT+ Sbjct: 1660 FGMPKQIVELKDTGTV 1675 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 22.6 bits (46), Expect = 4.2 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = -1 Query: 100 FGLPRRTLVFKDEGTI 53 FG+P++ + KD GT+ Sbjct: 1661 FGMPKQIVELKDTGTV 1676 >Z22930-7|CAA80512.1| 274|Anopheles gambiae trypsin protein. Length = 274 Score = 21.8 bits (44), Expect = 7.3 Identities = 11/37 (29%), Positives = 14/37 (37%) Frame = -2 Query: 309 CGYGXEPARHLHVHPSPEFQGPQRVSGHRRECGALRV 199 C RH V PSP F R + +R G + Sbjct: 18 CAEAQANQRHRLVRPSPSFSPRPRYAVGQRIVGGFEI 54 >Z18889-1|CAA79327.1| 274|Anopheles gambiae trypsin protein. Length = 274 Score = 21.8 bits (44), Expect = 7.3 Identities = 11/37 (29%), Positives = 14/37 (37%) Frame = -2 Query: 309 CGYGXEPARHLHVHPSPEFQGPQRVSGHRRECGALRV 199 C RH V PSP F R + +R G + Sbjct: 18 CAEAQANQRHRLVRPSPSFSPRPRYAVGQRIVGGFEI 54 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 21.8 bits (44), Expect = 7.3 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -2 Query: 270 HPSPEFQGPQRVSGHRRE 217 HP P PQR S RR+ Sbjct: 206 HPQPIVPQPQRASLERRD 223 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 21.8 bits (44), Expect = 7.3 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -2 Query: 270 HPSPEFQGPQRVSGHRRE 217 HP P PQR S RR+ Sbjct: 206 HPQPIVPQPQRASLERRD 223 >AF543192-1|AAN40409.1| 636|Anopheles gambiae amino acid transporter Ag_AAT8 protein. Length = 636 Score = 21.8 bits (44), Expect = 7.3 Identities = 10/33 (30%), Positives = 15/33 (45%) Frame = +3 Query: 6 GNPVPIPEPGSGTVSIIVPSSLKTSVRRGNPKW 104 G VP P P +G + VP+S+ +W Sbjct: 50 GKTVPRPTPATGEDAGRVPTSIIPEPNADRDQW 82 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 21.4 bits (43), Expect = 9.6 Identities = 6/14 (42%), Positives = 9/14 (64%) Frame = +3 Query: 102 WPEDAAERSGKSFL 143 WPE +SG+ F+ Sbjct: 1127 WPEQGVPKSGQGFI 1140 >DQ974163-1|ABJ52803.1| 595|Anopheles gambiae serpin 4B protein. Length = 595 Score = 21.4 bits (43), Expect = 9.6 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -3 Query: 317 RPAADMGXNRRDISTYIP 264 RP+ +G +RD+S +P Sbjct: 466 RPSGRVGRTKRDVSYKVP 483 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 388,431 Number of Sequences: 2352 Number of extensions: 8175 Number of successful extensions: 22 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 56 effective length of database: 432,267 effective search space used: 24206952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -