BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0482 (340 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to ... 29 1.0 At5g42370.1 68418.m05159 expressed protein 29 1.0 At3g13320.1 68416.m01677 calcium exchanger (CAX2) almost identic... 29 1.0 At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipox... 28 1.8 At5g22390.1 68418.m02612 expressed protein 27 2.4 At3g56510.1 68416.m06284 TBP-binding protein, putative similar t... 27 3.2 At2g05210.1 68415.m00549 expressed protein 27 3.2 At2g03890.2 68415.m00352 phosphatidylinositol 3- and 4-kinase fa... 27 3.2 At2g03890.1 68415.m00351 phosphatidylinositol 3- and 4-kinase fa... 27 3.2 At3g53900.2 68416.m05955 uracil phosphoribosyltransferase, putat... 27 4.2 At3g02270.1 68416.m00208 eIF4-gamma/eIF5/eIF2-epsilon domain-con... 27 4.2 At5g56500.1 68418.m07051 chaperonin, putative similar to SWISS-P... 26 5.6 At3g04340.1 68416.m00459 FtsH protease family protein similar to... 26 5.6 At1g60230.1 68414.m06783 radical SAM domain-containing protein ... 26 5.6 At3g60510.1 68416.m06768 enoyl-CoA hydratase/isomerase family pr... 26 7.4 At5g61910.3 68418.m07772 expressed protein 25 9.7 At5g61910.2 68418.m07771 expressed protein 25 9.7 At5g61910.1 68418.m07770 expressed protein 25 9.7 At4g39970.1 68417.m05661 haloacid dehalogenase-like hydrolase fa... 25 9.7 At4g21520.1 68417.m03110 transducin family protein / WD-40 repea... 25 9.7 At3g55810.1 68416.m06201 pyruvate kinase, putative similar to py... 25 9.7 At3g19190.1 68416.m02436 expressed protein 25 9.7 At1g76470.1 68414.m08895 cinnamoyl-CoA reductase family similar ... 25 9.7 At1g28060.1 68414.m03435 small nuclear ribonucleoprotein family ... 25 9.7 >At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to autophagy 7 [Arabidopsis thaliana] GI:19912147; contains Pfam profile PF00899: ThiF family Length = 697 Score = 28.7 bits (61), Expect = 1.0 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = -2 Query: 246 PQRVSGHRRECGALRVPNHISLL*DSMELERSGRKENSSRTSRRR 112 P ++G CG +V NH++LL +S+ L+ ++S +R + Sbjct: 42 PISITGFYGPCGHPQVSNHLTLLSESLPLDEQSLIASTSHGNRNK 86 >At5g42370.1 68418.m05159 expressed protein Length = 447 Score = 28.7 bits (61), Expect = 1.0 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -3 Query: 185 PFYRIPWNSNAQAEKKTLPGPLGGVFRPL-WVTPSNTR 75 P Y + + Q+ +K +P PL + R L W TPS R Sbjct: 285 PLYDVTSSGLVQSVEKVVPRPLRSIVRLLFWYTPSTMR 322 >At3g13320.1 68416.m01677 calcium exchanger (CAX2) almost identical to low affinity calcium antiporter CAX2 (GI:1488267) [Arabidopsis thaliana]; Ca2+:Cation Antiporter (CaCA) Family member PMID:11500563 Length = 441 Score = 28.7 bits (61), Expect = 1.0 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = +3 Query: 48 SIIVPSSLKTSVRRGNPKWPEDAAERSGKSFLFC--LSVRVPWNPI 179 S++ SL TS + PK P+++ S K +FC L++ +P+ P+ Sbjct: 41 SLMEQGSLSTSFPQHTPKAPKNSVLNSIKIVIFCNKLNLLLPFGPL 86 >At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipoxygenase gi:1495804 [Solanum tuberosum], gi:1654140 [Lycopersicon esculentum], GB:CAB56692 [Arabidopsis thaliana] Length = 926 Score = 27.9 bits (59), Expect = 1.8 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -1 Query: 241 ESIRTPPRMRCSSRSEPYLPSIGFHGTRTLRQK 143 +S + P R ++PYLPS G RTLR+K Sbjct: 215 QSQKDHPSKRILFTNQPYLPSETPSGLRTLREK 247 >At5g22390.1 68418.m02612 expressed protein Length = 202 Score = 27.5 bits (58), Expect = 2.4 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +3 Query: 120 ERSGKSFLFCLSVRVPWNPIEG 185 + S KSFL LS PWNP +G Sbjct: 17 DNSPKSFLDTLSSSSPWNPSKG 38 >At3g56510.1 68416.m06284 TBP-binding protein, putative similar to TBP-binding protein ABT1 GI:6518527 from [Mus musculus] Length = 257 Score = 27.1 bits (57), Expect = 3.2 Identities = 17/68 (25%), Positives = 28/68 (41%) Frame = -3 Query: 212 VLFAFRTISPFYRIPWNSNAQAEKKTLPGPLGGVFRPLWVTPSNTRF*RRGNDY*NGSAA 33 +L + + Y P +S AQ +K G G F WV + +R D NG Sbjct: 69 ILAQYGELGRIYLAPEDSEAQVHRKRAGGFRGQRFSEGWVEFAKKSVAKRVADMLNGEQI 128 Query: 32 GFRNRNRI 9 G + ++ + Sbjct: 129 GGKKKSSV 136 >At2g05210.1 68415.m00549 expressed protein Length = 364 Score = 27.1 bits (57), Expect = 3.2 Identities = 18/52 (34%), Positives = 24/52 (46%) Frame = -1 Query: 241 ESIRTPPRMRCSSRSEPYLPSIGFHGTRTLRQKRKLFPDLSAASSGHFGLPR 86 +S T C+ +E Y +GF T TLR+KR L S +F PR Sbjct: 282 DSTATLEAFLCNKDAE-YFWGLGFQDTETLRKKRNWL--LGIRESSNFVAPR 330 >At2g03890.2 68415.m00352 phosphatidylinositol 3- and 4-kinase family protein low similarity to phosphatidylinositol 4-kinase type-II beta [Homo sapiens] GI:20159767; contains Pfam profile PF00454: Phosphatidylinositol 3- and 4-kinase Length = 530 Score = 27.1 bits (57), Expect = 3.2 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = -2 Query: 168 MELERSGRKENSSRTSRRRLQATLGYPVEHSFLKTRERLL 49 MEL+RS ++ T +RRLQ L +P E S L + +L Sbjct: 60 MELDRS----DNVHTVKRRLQIALNFPTEESSLTYGDMVL 95 >At2g03890.1 68415.m00351 phosphatidylinositol 3- and 4-kinase family protein low similarity to phosphatidylinositol 4-kinase type-II beta [Homo sapiens] GI:20159767; contains Pfam profile PF00454: Phosphatidylinositol 3- and 4-kinase Length = 650 Score = 27.1 bits (57), Expect = 3.2 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = -2 Query: 168 MELERSGRKENSSRTSRRRLQATLGYPVEHSFLKTRERLL 49 MEL+RS ++ T +RRLQ L +P E S L + +L Sbjct: 60 MELDRS----DNVHTVKRRLQIALNFPTEESSLTYGDMVL 95 >At3g53900.2 68416.m05955 uracil phosphoribosyltransferase, putative / UMP pyrophosphorylase, putative / UPRTase, putative similar to SP|P50926 Uracil phosphoribosyltransferase (EC 2.4.2.9) (UMP pyrophosphorylase) (UPRTase) {Lactococcus lactis}; contains Pfam profile PF00156: Phosphoribosyl transferase domain Length = 296 Score = 26.6 bits (56), Expect = 4.2 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 1/58 (1%) Frame = -1 Query: 247 SAESIRTPPRMRCSSRSEPYLPS-IGFHGTRTLRQKRKLFPDLSAASSGHFGLPRRTL 77 S++++R PR +CSSR P S + F+ + L Q +L A+SS L RRT+ Sbjct: 12 SSDTLRFAPRQQCSSRLNPNPSSFLSFNSSPILAQ------NLGASSS---SLSRRTI 60 >At3g02270.1 68416.m00208 eIF4-gamma/eIF5/eIF2-epsilon domain-containing protein similar to SP|Q13144 Translation initiation factor eIF-2B epsilon subunit (eIF-2B GDP-GTP exchange factor) {Homo sapiens}; contains Pfam profile PF02020: eIF4-gamma/eIF5/eIF2-epsilon Length = 676 Score = 26.6 bits (56), Expect = 4.2 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -1 Query: 202 RSEPYLPSIGFHGTRTLRQKRK 137 R+ PY+P + F G RTL+ +R+ Sbjct: 288 RTFPYVPDMKFSGNRTLKLERQ 309 >At5g56500.1 68418.m07051 chaperonin, putative similar to SWISS-PROT:P08927- RuBisCO subunit binding-protein beta subunit, chloroplast precursor (60 kDa chaperonin beta subunit, CPN-60 beta) [Pisum sativum]; contains Pfam:PF00118 domain, TCP-1/cpn60 chaperonin family Length = 597 Score = 26.2 bits (55), Expect = 5.6 Identities = 17/50 (34%), Positives = 24/50 (48%) Frame = -1 Query: 247 SAESIRTPPRMRCSSRSEPYLPSIGFHGTRTLRQKRKLFPDLSAASSGHF 98 S S PP R SS + S F T+++ Q++ FP + AA HF Sbjct: 10 SMGSSLAPPSNRLSSFVS--ISSSSFGRTQSIAQRKARFPKIYAAKQLHF 57 >At3g04340.1 68416.m00459 FtsH protease family protein similar to chloroplast FtsH protease [Arabidopsis thaliana] GI:1483215; contains Pfam profiles PF01434: Peptidase family M41, PF00004: ATPase AAA family Length = 960 Score = 26.2 bits (55), Expect = 5.6 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = +3 Query: 39 GTVSIIVPSSLKTSVRRGNPKWPEDA 116 G ++VP +++ +R G KW E+A Sbjct: 81 GEKEVVVPKAIQLHLRHGWKKWQEEA 106 >At1g60230.1 68414.m06783 radical SAM domain-containing protein contains Pfam profile PF04055: radical SAM domain protein Length = 458 Score = 26.2 bits (55), Expect = 5.6 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = -1 Query: 133 FPDLSAASSGHFGLPRRTLVFKDEGTIIETVPLP 32 F D+ +AS G R+ L D+G +IETV +P Sbjct: 161 FKDIRSASDG----TRKILFTLDDGLVIETVVIP 190 >At3g60510.1 68416.m06768 enoyl-CoA hydratase/isomerase family protein similar to enoyl-CoA-hydratase, Avicennia marina, EMBL:AF190450 [GI:6014701], CoA-thioester hydrolase CHY1 from Arabidopsis thaliana [GI:8572760]; contains Pfam profile PF00378 enoyl-CoA hydratase/isomerase family protein Length = 401 Score = 25.8 bits (54), Expect = 7.4 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = -2 Query: 174 DSMELERSGRKENSSRTSRRRLQATLGYPVEHSFLKTRE-RLLKRFRCRVPE 22 DS+E+E S RK+ T+ RRL+ + ++ + RE RL +C + E Sbjct: 280 DSLEIEASRRKDTWCITTLRRLKESSPLSLKVALRSIREGRLQTLDQCLIRE 331 >At5g61910.3 68418.m07772 expressed protein Length = 742 Score = 25.4 bits (53), Expect = 9.7 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -1 Query: 277 PRTSLT*ISR-SAESIRTPPRMRCSSRSEPYLPS 179 PRTSL S + TPPR S+ ++PY P+ Sbjct: 253 PRTSLLQHSYFRQDDYTTPPRESLSNLNQPYYPT 286 >At5g61910.2 68418.m07771 expressed protein Length = 738 Score = 25.4 bits (53), Expect = 9.7 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -1 Query: 277 PRTSLT*ISR-SAESIRTPPRMRCSSRSEPYLPS 179 PRTSL S + TPPR S+ ++PY P+ Sbjct: 249 PRTSLLQHSYFRQDDYTTPPRESLSNLNQPYYPT 282 >At5g61910.1 68418.m07770 expressed protein Length = 738 Score = 25.4 bits (53), Expect = 9.7 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -1 Query: 277 PRTSLT*ISR-SAESIRTPPRMRCSSRSEPYLPS 179 PRTSL S + TPPR S+ ++PY P+ Sbjct: 249 PRTSLLQHSYFRQDDYTTPPRESLSNLNQPYYPT 282 >At4g39970.1 68417.m05661 haloacid dehalogenase-like hydrolase family protein low similarity to SP|P95649 CbbY protein {Rhodobacter sphaeroides} Length = 316 Score = 25.4 bits (53), Expect = 9.7 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 3/48 (6%) Frame = -1 Query: 178 IGFHGTRTLRQKRKLFPDLSAASSGHFGLPRRT---LVFKDEGTIIET 44 IGF +TLR K + S SS LP R+ L+F +G I+E+ Sbjct: 30 IGFPRFQTLRFKSRSVYSKSRVSSPVSALPLRSLEALIFDCDGVILES 77 >At4g21520.1 68417.m03110 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to guanine nucleotide-binding protein beta 5 (GI:1001939) [Mesocricetus auratus] Length = 425 Score = 25.4 bits (53), Expect = 9.7 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +3 Query: 192 GSEREEHRIRGGVRILSADLEIQVRDVRGDVAPVRTH 302 G E GG+++ S + + +R DV+P RTH Sbjct: 2 GEEEAVAEENGGLKVESGEQKSSWPTMRFDVSPYRTH 38 >At3g55810.1 68416.m06201 pyruvate kinase, putative similar to pyruvate kinase, cytosolic isozyme [Nicotiana tabacum] SWISS-PROT:Q42954 Length = 492 Score = 25.4 bits (53), Expect = 9.7 Identities = 16/41 (39%), Positives = 24/41 (58%) Frame = -2 Query: 168 MELERSGRKENSSRTSRRRLQATLGYPVEHSFLKTRERLLK 46 ME+ GR N + S+ ++ TLG PV S ++ E+LLK Sbjct: 1 MEMLLGGRATNGALRSKTKIVCTLG-PVSRS-VEMIEKLLK 39 >At3g19190.1 68416.m02436 expressed protein Length = 1861 Score = 25.4 bits (53), Expect = 9.7 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 21 IPEPGSGTVSIIVPSSLKTSVRRGNPKWPEDAAER 125 +P+ G + + P +T +RRGN W +DA+ R Sbjct: 1361 VPQEGDSSGRELFP---ETDLRRGNSGWYDDASLR 1392 >At1g76470.1 68414.m08895 cinnamoyl-CoA reductase family similar to cinnamoyl-CoA reductase GB:CAA56103 [Eucalyptus gunnii], Pinus taeda [GI:17978649]; contains non-consensus GG acceptor splice site at exon 4 Length = 317 Score = 25.4 bits (53), Expect = 9.7 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +3 Query: 51 IIVPSSLKTSVRRGNPKWPEDAAE 122 ++V SS+ V NPKWP+D A+ Sbjct: 116 VVVVSSIAAVVY--NPKWPQDVAK 137 >At1g28060.1 68414.m03435 small nuclear ribonucleoprotein family protein / snRNP family protein contains similarity to U4/U6 small nuclear ribonucleoprotein hPrp3 [Homo sapiens] gi|2708307|gb|AAC51926 Length = 786 Score = 25.4 bits (53), Expect = 9.7 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +3 Query: 159 RVPWNPIEGRYGSEREEHRIRGG 227 R+ W E + G+E EE + GG Sbjct: 712 RINWEEAERKEGNEDEEEEVNGG 734 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,054,703 Number of Sequences: 28952 Number of extensions: 166374 Number of successful extensions: 541 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 529 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 539 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 399440640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -