BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0472 (353 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39745| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.3 SB_21| Best HMM Match : NOC3p (HMM E-Value=0.0058) 27 5.8 >SB_39745| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 996 Score = 27.5 bits (58), Expect = 3.3 Identities = 15/41 (36%), Positives = 19/41 (46%) Frame = -1 Query: 284 NSANIYIHLFSKTCLFVNNLKSNLPTDIFIKGLQYFDCTKV 162 N NI I L + LF N +PTDI + L +KV Sbjct: 229 NIKNIIISLIDRLALFANRDDGGIPTDIKLFDLMSEQVSKV 269 >SB_21| Best HMM Match : NOC3p (HMM E-Value=0.0058) Length = 423 Score = 26.6 bits (56), Expect = 5.8 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +2 Query: 65 IKKLNSIFFIKETVYISSNLSYKSSIKRLMIMLP 166 + K+ +I+F+KET Y + L SS+ L + LP Sbjct: 383 VNKMKNIYFMKETSYDNQTL-VTSSMTSLEVKLP 415 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,241,648 Number of Sequences: 59808 Number of extensions: 84813 Number of successful extensions: 115 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 112 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 115 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 548040812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -