BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0470 (708 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCP25A2.02c |rhp26||SNF2 family helicase Rhp26|Schizosaccharomy... 26 6.1 SPAC1F7.08 |fio1||iron transport multicopper oxidase Fio1|Schizo... 26 6.1 >SPCP25A2.02c |rhp26||SNF2 family helicase Rhp26|Schizosaccharomyces pombe|chr 3|||Manual Length = 973 Score = 25.8 bits (54), Expect = 6.1 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -3 Query: 565 GARKVTTGITGLWQPSVHSTLLFDPSMSALPII 467 G KV + LW+ H TLLF + L I+ Sbjct: 625 GKLKVIRALLTLWKKQGHRTLLFSQTRQMLDIL 657 >SPAC1F7.08 |fio1||iron transport multicopper oxidase Fio1|Schizosaccharomyces pombe|chr 1|||Manual Length = 622 Score = 25.8 bits (54), Expect = 6.1 Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 3/53 (5%) Frame = -3 Query: 622 IGTAKARPIDPLV*EFLARGARKVTTGITGLWQPSVHSTLLFD---PSMSALP 473 IG PIDPLV ++ + K+T + S+HS LF P M +P Sbjct: 49 IGVNNKWPIDPLVVDYGDQVIIKMTNSLANNRTTSLHSHGLFQKFTPYMDGVP 101 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,899,094 Number of Sequences: 5004 Number of extensions: 57843 Number of successful extensions: 160 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 155 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 160 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 329179816 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -