BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0469 (714 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15146| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.70 SB_43041| Best HMM Match : F5_F8_type_C (HMM E-Value=2.3e-10) 31 0.93 >SB_15146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 31.5 bits (68), Expect = 0.70 Identities = 17/67 (25%), Positives = 31/67 (46%) Frame = -1 Query: 462 DETIIHSCSICGIVPY*LQVPSSKIYVKCHWVSKAKLTIVTLSLQRPSALSGIIYCRIQN 283 DET +H C ++ + VPS + +C + S + L L ++C I N Sbjct: 8 DETAVHGCRTARVIDC-VSVPSWPDWCQCVYASVLLKSTFKLQLAARENSLARMFCHISN 66 Query: 282 SNRLRSH 262 ++R+ S+ Sbjct: 67 NSRIPSY 73 >SB_43041| Best HMM Match : F5_F8_type_C (HMM E-Value=2.3e-10) Length = 234 Score = 31.1 bits (67), Expect = 0.93 Identities = 17/47 (36%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = -1 Query: 267 SHWLFRELGRNRNYSEFGF--EWFPDICQLGRYLRFKLYSVAWNTNI 133 SH F GR N FG W P + Q G Y + L V W T++ Sbjct: 125 SHQHFPHFGRLNNQPAFGHIGVWAPIVSQKGEYKQVDLGRVTWITHV 171 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,342,802 Number of Sequences: 59808 Number of extensions: 438469 Number of successful extensions: 773 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 728 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 773 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1889780269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -