Bombyx BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVm0469
         (714 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z99773-2|CAB16924.1|  291|Caenorhabditis elegans Hypothetical pr...    33   0.27 

>Z99773-2|CAB16924.1|  291|Caenorhabditis elegans Hypothetical
           protein H06A10.1 protein.
          Length = 291

 Score = 32.7 bits (71), Expect = 0.27
 Identities = 26/71 (36%), Positives = 40/71 (56%), Gaps = 2/71 (2%)
 Frame = +2

Query: 71  TLLRFMKNNLFGIVFLMNAT--QIFVFQATEYNLNRKYRPNWQISGNHSKPNSE*FRFRP 244
           +L  F ++++ G VFL+N+T  QI  F+ T+ NL     P   IS N+ K   + +R   
Sbjct: 27  SLGEFSESDVEGEVFLVNSTHLQIVNFRTTKTNL--PPIPFAFISSNNQKSTPKIYR-HF 83

Query: 245 SSRNSQWLRNL 277
           SS+N +WL  L
Sbjct: 84  SSQNGEWLSKL 94


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,364,833
Number of Sequences: 27780
Number of extensions: 345560
Number of successful extensions: 690
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 665
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 690
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1666201324
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)