BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0469 (714 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g37810.1 68415.m04642 CHP-rich zinc finger protein, putative 31 0.57 At5g13270.1 68418.m01524 pentatricopeptide (PPR) repeat-containi... 28 5.3 >At2g37810.1 68415.m04642 CHP-rich zinc finger protein, putative Length = 233 Score = 31.5 bits (68), Expect = 0.57 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = -1 Query: 549 TIVFYISHRFHAQFLTNG*ENCCEIAFSLDETIIHSCSICG 427 T++ ++ + + NG EN C I L E + + C CG Sbjct: 62 TLISFMHPQHELRLFVNGSENMCNICHRLVEGVYYHCETCG 102 >At5g13270.1 68418.m01524 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 752 Score = 28.3 bits (60), Expect = 5.3 Identities = 10/30 (33%), Positives = 20/30 (66%) Frame = -1 Query: 390 IYVKCHWVSKAKLTIVTLSLQRPSALSGII 301 +YVKC W+ AK +++++P A +G++ Sbjct: 228 MYVKCGWLVGAKRVFDQMAVKKPVACTGLM 257 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,086,435 Number of Sequences: 28952 Number of extensions: 307483 Number of successful extensions: 637 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 627 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 637 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1545769616 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -