BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0467 (661 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 189 2e-48 SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) 189 2e-48 SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) 116 2e-26 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) 93 2e-19 SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_30962| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_20773| Best HMM Match : DNA_pol_B_exo (HMM E-Value=2.5e-37) 93 2e-19 SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) 93 2e-19 SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_52557| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_51064| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_48482| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_47507| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_46751| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_42028| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_40596| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_39544| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_39345| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) 93 2e-19 SB_37260| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_35695| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_35230| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_35048| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_34691| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_34125| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_32443| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_29553| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_29380| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_23079| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_22871| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_22715| Best HMM Match : SAM_PNT (HMM E-Value=1.8) 93 2e-19 SB_21148| Best HMM Match : PAN (HMM E-Value=0.49) 93 2e-19 SB_19464| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_18801| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_18037| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_17135| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_16602| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_16324| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_16101| Best HMM Match : RVT_1 (HMM E-Value=0.00031) 93 2e-19 SB_15175| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_15145| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_14442| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_10623| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_8423| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_7697| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_7274| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_5755| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 89 2e-18 SB_35724| Best HMM Match : No HMM Matches (HMM E-Value=.) 89 2e-18 SB_7309| Best HMM Match : No HMM Matches (HMM E-Value=.) 89 2e-18 SB_1903| Best HMM Match : No HMM Matches (HMM E-Value=.) 89 2e-18 SB_34414| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_33488| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_27738| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_25122| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_38053| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 4e-14 SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) 74 1e-13 SB_21707| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_58224| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_55737| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_54286| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_54219| Best HMM Match : Toxin_8 (HMM E-Value=8.1) 73 3e-13 SB_41217| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_38325| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_17471| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_16089| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_9623| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_59708| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_59685| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_59589| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_59479| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_58142| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_57899| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_57889| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_57793| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_57693| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_57320| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_55905| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_55790| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_55716| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_55631| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_55333| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_55090| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_54702| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_54683| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_54384| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_53884| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_53624| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_53241| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_52402| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_51349| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_51271| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_50626| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_49587| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_49375| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_49357| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_49260| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_49181| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_48829| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_48601| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_48323| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_48037| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_47484| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_47382| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_47359| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_47312| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_46998| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_46785| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_46606| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_46553| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_46274| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_46222| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_46158| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_45670| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_45556| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_45238| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_44797| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_44462| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_43465| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_42828| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_42781| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_42533| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_42195| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_41845| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_40938| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_39214| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_38586| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_38311| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_37725| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_37267| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_37229| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_36145| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_35184| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_34961| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_34855| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_34644| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_34569| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_33632| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_33419| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_33059| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_32948| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_32667| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_32556| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_31680| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_31259| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_30530| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_30465| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_30185| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_29900| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_29015| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_28377| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_28369| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_28136| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_27976| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_27792| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_27734| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_26258| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_26165| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_25748| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_25006| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_24933| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_24744| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_24530| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_23602| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_23082| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_23076| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_22933| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_22408| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_22371| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_21708| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_21671| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_21133| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_21107| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_20737| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_20572| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_19574| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_19433| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_18666| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_17812| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_17809| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_17259| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_17176| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_16930| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_16732| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_16453| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_15769| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_15576| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_15019| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_14967| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_14861| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_14376| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_14280| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_14068| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_12970| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_12483| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_12400| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_11534| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_11286| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_11221| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_10946| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_10173| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_9717| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_9609| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_9186| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_9181| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_8946| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_8892| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_8840| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_8665| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_8650| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_8602| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_8412| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_8098| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_7942| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_7762| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_7701| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_5634| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_5583| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_5352| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_4816| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_4803| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_4739| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_4616| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_4498| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_4379| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_3983| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_3821| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_3004| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_2988| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_2927| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_2917| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_2901| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_2472| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_2187| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_2000| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_1929| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_1735| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_1566| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_1545| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_1521| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_1469| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_1412| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_1338| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_1265| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_756| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_338| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_305| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_300| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_251| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_33| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_3766| Best HMM Match : Moricin (HMM E-Value=5.1) 72 4e-13 SB_54507| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 6e-13 SB_58426| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 6e-13 SB_57366| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 6e-13 SB_56245| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 6e-13 SB_55566| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 6e-13 SB_55077| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 6e-13 SB_53790| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 6e-13 SB_52894| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 6e-13 SB_48533| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 6e-13 SB_47211| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 6e-13 SB_46066| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 6e-13 SB_45109| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 6e-13 SB_43715| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 6e-13 SB_42865| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 6e-13 SB_41269| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 6e-13 SB_40020| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 6e-13 SB_38531| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 6e-13 SB_35148| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 6e-13 SB_31008| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 6e-13 SB_29391| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 6e-13 SB_24808| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 6e-13 SB_23019| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 6e-13 SB_19542| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 6e-13 SB_19098| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 6e-13 SB_19031| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 6e-13 SB_17805| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 6e-13 SB_15695| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 6e-13 SB_12040| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 6e-13 SB_9760| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 6e-13 SB_5267| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 6e-13 SB_1707| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 6e-13 SB_1382| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 6e-13 SB_1275| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 6e-13 SB_30985| Best HMM Match : DUF1450 (HMM E-Value=1.5) 70 2e-12 SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 6e-12 SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 6e-12 SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 6e-12 SB_49591| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 6e-12 SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 6e-12 SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 6e-12 SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 6e-12 SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 6e-12 SB_51245| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 8e-12 SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_15857| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_6381| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_2599| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) 62 5e-10 SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) 61 7e-10 SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 7e-10 SB_19841| Best HMM Match : Myb_DNA-binding (HMM E-Value=1.1) 61 7e-10 SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) 60 1e-09 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_23874| Best HMM Match : SSIII (HMM E-Value=5.4) 60 1e-09 SB_58947| Best HMM Match : Helicase_C (HMM E-Value=0.058) 60 2e-09 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_47984| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_43222| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_857| Best HMM Match : Mago_nashi (HMM E-Value=0) 60 2e-09 SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) 60 2e-09 SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_58459| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) 60 2e-09 SB_58084| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_55949| Best HMM Match : FLYWCH (HMM E-Value=0.16) 60 2e-09 SB_55180| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) 60 2e-09 SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) 60 2e-09 SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_45733| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_45470| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) 60 2e-09 SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_39953| Best HMM Match : Ank (HMM E-Value=1.8e-19) 60 2e-09 SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) 60 2e-09 SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_35652| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) 60 2e-09 SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_30841| Best HMM Match : HLH (HMM E-Value=1.5) 60 2e-09 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_28553| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_26370| Best HMM Match : Drf_FH1 (HMM E-Value=5.2) 60 2e-09 SB_26141| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_25318| Best HMM Match : fn3 (HMM E-Value=2e-15) 60 2e-09 SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) 60 2e-09 SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_23451| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) 60 2e-09 SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_20654| Best HMM Match : Helicase_C (HMM E-Value=2.3e-21) 60 2e-09 SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) 60 2e-09 SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_19176| Best HMM Match : YGGT (HMM E-Value=1.1) 60 2e-09 SB_18680| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 60 2e-09 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) 60 2e-09 SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) 60 2e-09 SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) 60 2e-09 SB_10646| Best HMM Match : GPW_gp25 (HMM E-Value=5.8) 60 2e-09 SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) 60 2e-09 SB_3614| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 60 2e-09 SB_1174| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) 60 2e-09 SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_56924| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_55232| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) 60 2e-09 SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3) 60 2e-09 SB_52605| Best HMM Match : UPF0004 (HMM E-Value=3.6) 60 2e-09 SB_52560| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_51037| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_49985| Best HMM Match : RuvB_C (HMM E-Value=3.6) 60 2e-09 SB_49124| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_48664| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_47765| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_47738| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_47238| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_45871| Best HMM Match : ABC_tran (HMM E-Value=2.5e-08) 60 2e-09 SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_45393| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.088) 60 2e-09 SB_44008| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_43854| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.7) 60 2e-09 SB_43776| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_43062| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_42773| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_42727| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_40658| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_40501| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_40404| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_39352| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_39336| Best HMM Match : Kinesin (HMM E-Value=0) 60 2e-09 SB_39081| Best HMM Match : Pertussis_S2S3 (HMM E-Value=9.8) 60 2e-09 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_38298| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_37805| Best HMM Match : DoxA (HMM E-Value=1.7) 60 2e-09 SB_36672| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_36066| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_35778| Best HMM Match : Dickkopf_N (HMM E-Value=2.4) 60 2e-09 SB_35502| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_35393| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 60 2e-09 SB_34374| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_34337| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) 60 2e-09 SB_34031| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_33205| Best HMM Match : Mucin (HMM E-Value=0.0024) 60 2e-09 SB_32541| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_31524| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_31275| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_30687| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_29812| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_29441| Best HMM Match : MFS_1 (HMM E-Value=1.6e-12) 60 2e-09 SB_29161| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 60 2e-09 SB_27070| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_26894| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 >SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) Length = 271 Score = 189 bits (461), Expect = 2e-48 Identities = 84/86 (97%), Positives = 85/86 (98%) Frame = +3 Query: 252 KTCEQKASKRPGTVKRPRCWRXSIGSAPLTSITKIDAQVRGGETRQDYKDTRRFPLEAPS 431 +TCEQKASKRPGTVKRPRCWR SIGSAPLTSITKIDAQVRGGETRQDYKDTRRFPLEAPS Sbjct: 93 RTCEQKASKRPGTVKRPRCWRFSIGSAPLTSITKIDAQVRGGETRQDYKDTRRFPLEAPS 152 Query: 432 CALLFRPCRLPDTCPPFSLREAWRFL 509 CALLFRPCRLPDTCPPFSLREAWRFL Sbjct: 153 CALLFRPCRLPDTCPPFSLREAWRFL 178 Score = 97.5 bits (232), Expect = 8e-21 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +2 Query: 509 IAHAVGISVRCRSFAPSWAVCTNPPFSPTAAPYPVTIVLSPTR 637 IAHAVGISVRCRSFAPSWAVCTNPPFSPTAAPYPVTIVLSPTR Sbjct: 179 IAHAVGISVRCRSFAPSWAVCTNPPFSPTAAPYPVTIVLSPTR 221 >SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) Length = 347 Score = 189 bits (461), Expect = 2e-48 Identities = 84/86 (97%), Positives = 85/86 (98%) Frame = +3 Query: 252 KTCEQKASKRPGTVKRPRCWRXSIGSAPLTSITKIDAQVRGGETRQDYKDTRRFPLEAPS 431 +TCEQKASKRPGTVKRPRCWR SIGSAPLTSITKIDAQVRGGETRQDYKDTRRFPLEAPS Sbjct: 122 RTCEQKASKRPGTVKRPRCWRFSIGSAPLTSITKIDAQVRGGETRQDYKDTRRFPLEAPS 181 Query: 432 CALLFRPCRLPDTCPPFSLREAWRFL 509 CALLFRPCRLPDTCPPFSLREAWRFL Sbjct: 182 CALLFRPCRLPDTCPPFSLREAWRFL 207 >SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) Length = 203 Score = 116 bits (279), Expect = 2e-26 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = +1 Query: 52 LSSRETCRASCINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR 213 L+SRETCRASCINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR Sbjct: 90 LNSRETCRASCINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR 143 >SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 112 bits (270), Expect = 2e-25 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = +1 Query: 61 RETCRASCINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR 213 RETCRASCINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR Sbjct: 457 RETCRASCINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR 507 >SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) Length = 346 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 436 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_30962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 733 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_20773| Best HMM Match : DNA_pol_B_exo (HMM E-Value=2.5e-37) Length = 1652 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) Length = 348 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_52557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_51064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_48482| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_47507| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 917 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_46751| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 400 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_42028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_40596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_39544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_39345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 43.6 bits (98), Expect = 1e-04 Identities = 19/31 (61%), Positives = 22/31 (70%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLTQR 210 +C G +PLPRSLTR ARSF CGER +R Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKMAYER 107 >SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) Length = 846 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_37260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 818 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_35695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_35230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_35048| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_34691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_34125| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_32443| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_29553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 573 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_29380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_23079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_22871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_22715| Best HMM Match : SAM_PNT (HMM E-Value=1.8) Length = 996 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_21148| Best HMM Match : PAN (HMM E-Value=0.49) Length = 183 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_19464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1653 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_18801| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_18037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_17135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_16602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_16324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_16101| Best HMM Match : RVT_1 (HMM E-Value=0.00031) Length = 336 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_15175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_15145| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_14442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_10623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_8423| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_7697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_7274| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_5755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 8 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 130 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 89.4 bits (212), Expect = 2e-18 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +1 Query: 544 VVRSKLGCVHEPPVQPDRCALSGNYRLESNPVRHDLSPL 660 VVRSKLGCVHEPPVQPDRCALSGNYRLESNPVRHDLSPL Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNPVRHDLSPL 39 >SB_35724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 89.4 bits (212), Expect = 2e-18 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +1 Query: 544 VVRSKLGCVHEPPVQPDRCALSGNYRLESNPVRHDLSPL 660 VVRSKLGCVHEPPVQPDRCALSGNYRLESNPVRHDLSPL Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNPVRHDLSPL 39 >SB_7309| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 89.4 bits (212), Expect = 2e-18 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +1 Query: 544 VVRSKLGCVHEPPVQPDRCALSGNYRLESNPVRHDLSPL 660 VVRSKLGCVHEPPVQPDRCALSGNYRLESNPVRHDLSPL Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNPVRHDLSPL 39 >SB_1903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 89.4 bits (212), Expect = 2e-18 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +1 Query: 544 VVRSKLGCVHEPPVQPDRCALSGNYRLESNPVRHDLSPL 660 VVRSKLGCVHEPPVQPDRCALSGNYRLESNPVRHDLSPL Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNPVRHDLSPL 39 >SB_34414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 87.0 bits (206), Expect = 1e-17 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = +1 Query: 544 VVRSKLGCVHEPPVQPDRCALSGNYRLESNPVRHDLSPL 660 VVRSKLGCVHEPPVQPDRCALSGNYRLES PVRHDLSPL Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESKPVRHDLSPL 39 >SB_33488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 80.6 bits (190), Expect = 1e-15 Identities = 37/44 (84%), Positives = 38/44 (86%) Frame = +3 Query: 333 PLTSITKIDAQVRGGETRQDYKDTRRFPLEAPSCALLFRPCRLP 464 PLTSITK DAQ+ GGETRQDYKDTRRFPL APSCALLF P LP Sbjct: 119 PLTSITKSDAQISGGETRQDYKDTRRFPLAAPSCALLFLPFGLP 162 Score = 55.2 bits (127), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +2 Query: 62 GKPVVPAALMNRPTRGERRFAYW 130 GKPVVPAALMNRPTRGERRFAYW Sbjct: 2 GKPVVPAALMNRPTRGERRFAYW 24 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 >SB_27738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 52 Score = 80.2 bits (189), Expect = 1e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 544 VVRSKLGCVHEPPVQPDRCALSGNYRLESNPVRHDL 651 VVRSKLGCVHEPPVQPDRCALSGNYRLESNPVRH L Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNPVRHRL 36 >SB_25122| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 79.0 bits (186), Expect = 3e-15 Identities = 40/50 (80%), Positives = 41/50 (82%) Frame = -3 Query: 446 EQESARGSFQGETPGIFIVLSGFATSDLSVDFCDARQGGGAYGXTPATRP 297 EQESARGS QGET GIFIVLSGFAT+DLSV F DA QGGGAYG T RP Sbjct: 10 EQESARGSRQGETLGIFIVLSGFATTDLSVRFRDACQGGGAYGKTALPRP 59 >SB_38053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 75.4 bits (177), Expect = 4e-14 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = +1 Query: 553 SKLGCVHEPPVQPDRCALSGNYRLESNPVRHDLSPL 660 S LGCVHEPPVQPDRCALSGNYRLESNP R DLSPL Sbjct: 56 SNLGCVHEPPVQPDRCALSGNYRLESNPGRPDLSPL 91 >SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) Length = 229 Score = 73.7 bits (173), Expect = 1e-13 Identities = 47/92 (51%), Positives = 51/92 (55%) Frame = +3 Query: 291 VKRPRCWRXSIGSAPLTSITKIDAQVRGGETRQDYKDTRRFPLEAPSCALLFRPCRLPDT 470 V+ PR R SIGSAPLTSITK DAQ+ GGETRQDYKDTRR C +L P Sbjct: 143 VRGPRQSRFSIGSAPLTSITKSDAQISGGETRQDYKDTRRLHQAGTLCGVLILPFGF--- 199 Query: 471 CPPFSLREAWRFL*LTL*VSQFGVGRSLQAGL 566 P S R R + V QF V SL GL Sbjct: 200 --PVSFRCYGRVSLMPTPVDQFRVDISLLEGL 229 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +2 Query: 56 PVGKPVVPAALMNRPTRGERRFAYW 130 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 37 PVGKPVVPAALMNRPTRGERRFAYW 61 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 118 VCVLGALPLPRSLTRCARSFGCGERYQLT 204 +C G +PLPRSLTR ARSF CGER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 >SB_21707| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 73.3 bits (172), Expect = 2e-13 Identities = 34/56 (60%), Positives = 40/56 (71%) Frame = +1 Query: 493 KRGAFYSSRCRYLSSV*VVRSKLGCVHEPPVQPDRCALSGNYRLESNPVRHDLSPL 660 +RG + R + + VRSKL C+HEPPVQ DRCALSGNYRLESNP RH +PL Sbjct: 4 ERGGDFVEDARKILNREAVRSKLDCMHEPPVQSDRCALSGNYRLESNPERHAKAPL 59 >SB_58224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_55737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_54286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_54219| Best HMM Match : Toxin_8 (HMM E-Value=8.1) Length = 75 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 45 [protein fragment, 31 aa] 75 >SB_41217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_38325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_17471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_16089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_9623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_59708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_59685| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_59589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_59479| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_58142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_57899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_57889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_57793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_57693| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_57320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_55905| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_55790| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_55716| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_55631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_55333| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_55090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_54702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_54683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_54384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_53884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 34 [protein fragment, 31 aa] 64 >SB_53624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_53241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_52402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_51349| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_51271| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_50626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_49587| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_49375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_49357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_49260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_49181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_48829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_48601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_48323| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_48037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_47484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_47382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_47359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_47312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_46998| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_46785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_46606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_46553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_46274| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_46222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_46158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_45670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_45556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_45238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_44797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_44462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_43465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_42828| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_42781| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_42533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_42195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_41845| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_40938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_39214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_38586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_38311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_37725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_37267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_37229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_36145| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_35184| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_34961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_34855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_34644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_34569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_33632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_33419| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_33059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_32948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_32667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_32556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_31680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_31259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_30530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_30465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_30185| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_29900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_29015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_28377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_28369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_28136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_27976| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_27792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_27734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_26258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_26165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_25748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_25006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_24933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_24744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_24530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_23602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_23082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_23076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_22933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_22408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_22371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_21708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_21671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_21133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_21107| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_20737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_20572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_19574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_19433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_18666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_17812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_17809| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_17259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_17176| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_16930| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_16732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_16453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_15769| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_15576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_15019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_14967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_14861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_14376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_14280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_14068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_12970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_12483| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_12400| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_11534| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_11286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_11221| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_10946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_10173| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_9717| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_9609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_9186| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_9181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_8946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_8892| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_8840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_8665| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_8650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_8602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_8412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_8098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_7942| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_7762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_7701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_5634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_5583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_5352| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_4816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_4803| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_4739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_4616| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_4498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_4379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_3983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_3821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_3004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_2988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_2927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_2917| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 >SB_2901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 544 [protein fragment, 31 aa] 636 [protein fragment, 31 aa] Sbjct: 1 [protein fragment, 31 aa] 31 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,707,221 Number of Sequences: 59808 Number of extensions: 489025 Number of successful extensions: 3209 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2438 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3203 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1693527500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -