BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0466 (673 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB107248-1|BAE72063.1| 278|Anopheles gambiae Bcl-2 family prote... 25 2.9 U28809-1|AAC47326.1| 140|Anopheles gambiae lysozyme protein. 24 3.8 DQ007317-1|AAY24699.1| 140|Anopheles gambiae lysozyme c-1 protein. 24 3.8 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 23 6.6 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 23 8.8 >AB107248-1|BAE72063.1| 278|Anopheles gambiae Bcl-2 family protein Anob-1 protein. Length = 278 Score = 24.6 bits (51), Expect = 2.9 Identities = 12/36 (33%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +1 Query: 7 VVNNLIIDKRRNTMEYCYKLWVG-NGQEIVRKYFPL 111 ++N I+ + RN+ME+C G G +VR+ P+ Sbjct: 85 LLNRKILQRLRNSMEHCMAGSGGLGGGAVVREALPI 120 >U28809-1|AAC47326.1| 140|Anopheles gambiae lysozyme protein. Length = 140 Score = 24.2 bits (50), Expect = 3.8 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -2 Query: 453 RTSFSYLAGWKNHCS 409 R F+ GWKNHC+ Sbjct: 115 RHGFNAWYGWKNHCN 129 >DQ007317-1|AAY24699.1| 140|Anopheles gambiae lysozyme c-1 protein. Length = 140 Score = 24.2 bits (50), Expect = 3.8 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -2 Query: 453 RTSFSYLAGWKNHCS 409 R F+ GWKNHC+ Sbjct: 115 RHGFNAWYGWKNHCN 129 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.4 bits (48), Expect = 6.6 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +2 Query: 254 RWKFITLWENNRVYFKIHNTKYNQYLKMSTTTCNCNSRDR 373 R FI+ W+ VY+ +H YN+ +S T S R Sbjct: 389 RCLFISHWQEEGVYWSLHYL-YNRLRDISEETSALPSHPR 427 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 23.0 bits (47), Expect = 8.8 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +1 Query: 187 STTNPSNERIPTAMV*TSILNSSLEVHYLVGEQQSVLQD 303 ST R+P ++ T+ + L + +G QSV+ D Sbjct: 6 STLTAGRHRLPALVLVTATILPILSLMVPIGHSQSVITD 44 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 662,542 Number of Sequences: 2352 Number of extensions: 12880 Number of successful extensions: 30 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67322955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -