BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0461 (704 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 23 3.7 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 23 3.7 S76957-1|AAB33932.1| 169|Apis mellifera olfactory receptor prot... 22 4.9 DQ435329-1|ABD92644.1| 150|Apis mellifera OBP12 protein. 22 6.5 DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 21 8.6 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 22.6 bits (46), Expect = 3.7 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = +1 Query: 385 YQTISLSICRGYLVALFRTYAYYKTIPHKCHFNLETRL 498 Y+ IC LF+ A+ K IPH LE ++ Sbjct: 227 YENAVSHICNATNKQLFQLVAWAKHIPHFTSLPLEDQV 264 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 22.6 bits (46), Expect = 3.7 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = +1 Query: 385 YQTISLSICRGYLVALFRTYAYYKTIPHKCHFNLETRL 498 Y+ IC LF+ A+ K IPH LE ++ Sbjct: 227 YENAVSHICNATNKQLFQLVAWAKHIPHFTSLPLEDQV 264 >S76957-1|AAB33932.1| 169|Apis mellifera olfactory receptor protein. Length = 169 Score = 22.2 bits (45), Expect = 4.9 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = +1 Query: 82 LYS*PSLVKFAVTLWMLILRYTFDWFYQNFYVCTN 186 ++S P+++ + + M ILR + D +NF C++ Sbjct: 88 VFSSPTILISYIYILMAILRMSADGGCRNFSTCSS 122 >DQ435329-1|ABD92644.1| 150|Apis mellifera OBP12 protein. Length = 150 Score = 21.8 bits (44), Expect = 6.5 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +1 Query: 586 VGCRCDLSLKFYICVIL*MR 645 V CD++L F +C++ MR Sbjct: 128 VNDECDVALSFKLCMLKAMR 147 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 21.4 bits (43), Expect = 8.6 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 497 FQVNLA*ICGITIKIILR 550 F++NL CG IK +LR Sbjct: 464 FRINLGIECGYEIKKLLR 481 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 188,977 Number of Sequences: 438 Number of extensions: 4392 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21683070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -