BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0461 (704 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g57660.1 68416.m06424 DNA-directed RNA polymerase family prot... 29 4.0 At1g75940.1 68414.m08820 glycosyl hydrolase family 1 protein / a... 27 9.2 >At3g57660.1 68416.m06424 DNA-directed RNA polymerase family protein similar to SP|O35134 DNA-directed RNA polymerase I largest subunit (EC 2.7.7.6) (RNA polymerase I 194 kDa subunit) (RPA194) {Mus musculus}; contains InterPro accession IPR000722: RNA polymerase, alpha subunit Length = 1670 Score = 28.7 bits (61), Expect = 4.0 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 2/40 (5%) Frame = -1 Query: 590 PTYN*LKYNIHMNFLRLFLW*CHKSML--DSPERRVSRLK 477 P Y+ L +N+ NFL+ + CH M + ER VS+LK Sbjct: 101 PIYHPLLFNLLFNFLQRACFFCHHFMAKPEDVERAVSQLK 140 >At1g75940.1 68414.m08820 glycosyl hydrolase family 1 protein / anther-specific protein ATA27 contains Pfam PF00232 : Glycosyl hydrolase family 1 domain; TIGRFAM TIGR01233: 6-phospho-beta-galactosidase; identical to anther-specific protein ATA27 (GI:2746341) [Arabidopsis thaliana] Length = 535 Score = 27.5 bits (58), Expect = 9.2 Identities = 10/34 (29%), Positives = 21/34 (61%) Frame = +1 Query: 448 YYKTIPHKCHFNLETRLSGESSIDLWHYHKNNLK 549 Y K PHKC+++ + + ++D +H +K ++K Sbjct: 74 YTKKFPHKCNYH-----NADVAVDFYHRYKEDIK 102 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,895,163 Number of Sequences: 28952 Number of extensions: 271423 Number of successful extensions: 507 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 498 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 507 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1516419560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -