BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0455 (508 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55241| Best HMM Match : PH (HMM E-Value=6.1e-12) 29 2.9 SB_8394| Best HMM Match : zf-C3HC4 (HMM E-Value=8.6e-08) 27 8.9 >SB_55241| Best HMM Match : PH (HMM E-Value=6.1e-12) Length = 734 Score = 28.7 bits (61), Expect = 2.9 Identities = 16/43 (37%), Positives = 25/43 (58%) Frame = -2 Query: 417 SGLPITLPLYPQAMR*PEGSTVLDSVKALLYSRL*M*NKTSLS 289 SGLP++LP+ P+A +G V +S+ ++ S KTS S Sbjct: 88 SGLPVSLPIAPEASG-DDGKEVFESLMEIVSSNCKESQKTSAS 129 >SB_8394| Best HMM Match : zf-C3HC4 (HMM E-Value=8.6e-08) Length = 1631 Score = 27.1 bits (57), Expect = 8.9 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 6/63 (9%) Frame = +3 Query: 33 TLSNDVQGDDGRPAYGDGKDKTSPRVSWKLIALWE------NNKVYFKILNTERNQYLVL 194 +LS ++ ++ R Y K K +WK +LWE N+K Y + E Q LV+ Sbjct: 504 SLSLRIKSENSREFYQSLKGKLQ---TWKCKSLWELLDNRANHKDYDRGTTCEHLQVLVI 560 Query: 195 GVG 203 G G Sbjct: 561 GAG 563 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,707,618 Number of Sequences: 59808 Number of extensions: 259944 Number of successful extensions: 744 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 714 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 744 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1111677931 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -