BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0455 (508 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 25 1.5 AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylch... 23 4.5 AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 23 5.9 AY341206-1|AAR13770.1| 196|Anopheles gambiae SP14D1 protein. 23 7.9 AF513635-1|AAM53607.1| 212|Anopheles gambiae glutathione S-tran... 23 7.9 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 25.0 bits (52), Expect = 1.5 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +3 Query: 45 DVQGDDGRPAYGDGKDKTSPRVSWKLIALWENNKVYFKILNTERNQYLVLGVG 203 D GD GRPAY D + +V + ++Y L TE ++ L+ G G Sbjct: 101 DRNGDGGRPAYSGNSDPSMDQVKTD-----KPRELYIPPLPTE-DESLIFGSG 147 >AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 6 protein. Length = 490 Score = 23.4 bits (48), Expect = 4.5 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -3 Query: 119 LPADSRACLVLAVAVGRSAIVALNIIAQ 36 LP DS L L V + S V LN++A+ Sbjct: 255 LPPDSGEKLTLGVTILLSLTVFLNLVAE 282 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 23.0 bits (47), Expect = 5.9 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +1 Query: 193 WESALTGTATIWPS 234 W S TGTA IW S Sbjct: 45 WVSDSTGTAAIWAS 58 >AY341206-1|AAR13770.1| 196|Anopheles gambiae SP14D1 protein. Length = 196 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +2 Query: 272 LQPAKYDNDVLFYIYNREYSKALTLSRTVEP 364 LQ + ND+ +NRE + + T+S P Sbjct: 41 LQDKSHHNDIALIRFNREINYSSTISAICLP 71 >AF513635-1|AAM53607.1| 212|Anopheles gambiae glutathione S-transferase D4 protein. Length = 212 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/33 (30%), Positives = 18/33 (54%), Gaps = 2/33 (6%) Frame = -1 Query: 259 SELSTLLTPKAI--WSPFQLVPTPNTKYWLRSV 167 +++ L+T A+ W ++L P P + WL V Sbjct: 153 ADICLLVTVNALTLWLGYELAPYPRIRDWLGRV 185 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 460,007 Number of Sequences: 2352 Number of extensions: 8936 Number of successful extensions: 33 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 45668772 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -