BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0452 (767 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0895 + 6877386-6878475,6878577-6878838,6878932-6879017,687... 30 1.8 06_01_0144 + 1089090-1091390 29 4.1 >06_01_0895 + 6877386-6878475,6878577-6878838,6878932-6879017, 6879117-6879274,6879554-6879630,6879719-6879785 Length = 579 Score = 30.3 bits (65), Expect = 1.8 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Frame = -2 Query: 619 NHNVCPFEVFLMSLCNIR-NNMLTVKLLLKHSYALNSTLIADLVTLWNYLTRQVKSGWGI 443 N V F V L+S I NN T+ L + L ++ L+TLW++L+R+ W I Sbjct: 30 NRFVALFAVPLLSFHFISTNNPYTMNLRFIAADTLQKLIVLALLTLWSHLSRRGSLEWTI 89 >06_01_0144 + 1089090-1091390 Length = 766 Score = 29.1 bits (62), Expect = 4.1 Identities = 16/59 (27%), Positives = 27/59 (45%) Frame = -2 Query: 595 VFLMSLCNIRNNMLTVKLLLKHSYALNSTLIADLVTLWNYLTRQVKSGWGIVSIGHCVL 419 V + LC N + K L +YA++S +++ LW + R + IV + C L Sbjct: 382 VMTIVLCGNGNVLYAFKSLTNDNYAVSSGILSLTKCLWKNVVRSPLVFFSIVDVSICYL 440 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,123,933 Number of Sequences: 37544 Number of extensions: 311477 Number of successful extensions: 603 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 594 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 603 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2063219900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -