BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0451 (722 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 25 1.8 AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcript... 24 4.1 AY028782-1|AAK32956.1| 501|Anopheles gambiae cytochrome P450 pr... 24 5.5 M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 23 7.2 Z22930-4|CAA80516.1| 267|Anopheles gambiae Trypsinogen precurso... 23 9.6 AY341205-1|AAR13769.1| 285|Anopheles gambiae period protein. 23 9.6 AY341204-1|AAR13768.1| 285|Anopheles gambiae period protein. 23 9.6 AY341203-1|AAR13767.1| 285|Anopheles gambiae period protein. 23 9.6 AY341202-1|AAR13766.1| 285|Anopheles gambiae period protein. 23 9.6 AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein p... 23 9.6 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 25.4 bits (53), Expect = 1.8 Identities = 21/60 (35%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +2 Query: 80 YHQDLHRRRLQAGSRPDPSALSVAH-VLLVTA**YQIKNLASHVPVTVVYRQNASAPSIS 256 YH D H A RP+PSA+ +A V V A + + A H PV Q+ A I+ Sbjct: 128 YHAD-HHTGFNAVVRPEPSAVKIAQPVHKVIAQPVHVSSYA-HAPVAHATVQHHHAAPIA 185 >AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcriptase protein. Length = 1009 Score = 24.2 bits (50), Expect = 4.1 Identities = 13/48 (27%), Positives = 25/48 (52%) Frame = +2 Query: 29 ETLLHVSPPGPRWSICYYHQDLHRRRLQAGSRPDPSALSVAHVLLVTA 172 +++ ++S P WSI Y+ +D+ +QA + + +LVTA Sbjct: 210 QSVRNLSRPITGWSIKYFSKDIFEVMMQAAVDTEVTTSEDLMRILVTA 257 >AY028782-1|AAK32956.1| 501|Anopheles gambiae cytochrome P450 protein. Length = 501 Score = 23.8 bits (49), Expect = 5.5 Identities = 11/33 (33%), Positives = 21/33 (63%) Frame = +3 Query: 222 CIGKTLQRHPFQGWLLRQVSRCTLLSGFRLPWP 320 CI ++L+++P L+RQVS+ + G + +P Sbjct: 359 CINESLRKYPPGANLIRQVSQDYRVPGTDVTFP 391 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 23.4 bits (48), Expect = 7.2 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 Query: 28 RNPSPRQSSRASLEYLLLPPRSAPTEAPSG 117 RN ++ RAS ++PPRS A G Sbjct: 225 RNQHEQEQPRASTSRAVMPPRSEALTAVRG 254 >Z22930-4|CAA80516.1| 267|Anopheles gambiae Trypsinogen precursor of ANTRYP7 protein. Length = 267 Score = 23.0 bits (47), Expect = 9.6 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = -2 Query: 514 ILNFKWVRTPAYSNDE-AGDLMTVPSGPILVSRTGAVG*TKRSVKAP 377 +LN KWV T A+ D +TV G + +G V R V+ P Sbjct: 71 VLNSKWVLTAAHCTDGLQAFTLTVRLGSSRHASSGTVVNVARIVEHP 117 >AY341205-1|AAR13769.1| 285|Anopheles gambiae period protein. Length = 285 Score = 23.0 bits (47), Expect = 9.6 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = -2 Query: 349 GVGRS*QQDGGHGSRNPLRSVQRLTCRSNQ 260 G G + GG GS P + L C+ N+ Sbjct: 253 GTGGTGTSSGGGGSFQPPTLTEELLCKHNE 282 >AY341204-1|AAR13768.1| 285|Anopheles gambiae period protein. Length = 285 Score = 23.0 bits (47), Expect = 9.6 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = -2 Query: 349 GVGRS*QQDGGHGSRNPLRSVQRLTCRSNQ 260 G G + GG GS P + L C+ N+ Sbjct: 253 GTGGTGTSSGGGGSFQPPTLTEELLCKHNE 282 >AY341203-1|AAR13767.1| 285|Anopheles gambiae period protein. Length = 285 Score = 23.0 bits (47), Expect = 9.6 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = -2 Query: 349 GVGRS*QQDGGHGSRNPLRSVQRLTCRSNQ 260 G G + GG GS P + L C+ N+ Sbjct: 253 GTGGTGTSSGGGGSFQPPTLTEELLCKHNE 282 >AY341202-1|AAR13766.1| 285|Anopheles gambiae period protein. Length = 285 Score = 23.0 bits (47), Expect = 9.6 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = -2 Query: 349 GVGRS*QQDGGHGSRNPLRSVQRLTCRSNQ 260 G G + GG GS P + L C+ N+ Sbjct: 253 GTGGTGTSSGGGGSFQPPTLTEELLCKHNE 282 >AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein protein. Length = 492 Score = 23.0 bits (47), Expect = 9.6 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +2 Query: 188 KNLASHVPVTVVYRQNASAPSISGLVASAG 277 +NL S R APS S LVASAG Sbjct: 174 RNLRSTEEADDAKRAKNDAPSGSSLVASAG 203 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 798,957 Number of Sequences: 2352 Number of extensions: 17355 Number of successful extensions: 298 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 297 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 298 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73597131 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -