BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0451 (722 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT012669-1|AAT08475.1| 46|Drosophila melanogaster LD48059p pro... 32 0.91 AE014297-4778|AAN14281.1| 1121|Drosophila melanogaster CG1815-PB... 29 8.5 >BT012669-1|AAT08475.1| 46|Drosophila melanogaster LD48059p protein. Length = 46 Score = 31.9 bits (69), Expect = 0.91 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -3 Query: 720 ETLMEDRSDSDVQIDRRN 667 ETLMEDR+ SDVQID +N Sbjct: 29 ETLMEDRNSSDVQIDCQN 46 >AE014297-4778|AAN14281.1| 1121|Drosophila melanogaster CG1815-PB, isoform B protein. Length = 1121 Score = 28.7 bits (61), Expect = 8.5 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +3 Query: 309 LPWPPSCCHERPTPFMVSHERFLGALTLRLVHPTAPVLLTK 431 +P PP +P RF+G T++ V+P P+ LT+ Sbjct: 1012 MPPPPPLPPREESPATADSVRFVGDTTIQRVYPRHPLQLTR 1052 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 35,652,879 Number of Sequences: 53049 Number of extensions: 817104 Number of successful extensions: 2252 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2131 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2252 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3231892257 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -